KEGG   Frankia alni: FRAAL6077Help
Entry
FRAAL6077         CDS       T00384                                 

Gene name
phoD
Definition
(GenBank) Phosphodiesterase/alkaline phosphatase D
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
fal  Frankia alni
Pathway
fal00790  Folate biosynthesis
fal01100  Metabolic pathways
fal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRAAL6077 (phoD)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FRAAL6077 (phoD)
Enzymes [BR:fal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FRAAL6077 (phoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Pur_ac_phosph_N Metallophos
Motif
Other DBs
NCBI-ProteinID: CAJ64701
RhizoBase: FRAAL6077
UniProt: Q0RCX3
Position
6592208..6593941
Genome map
AA seq 577 aa AA seqDB search
MTGDATAGPSRPLRSLFAGAASTPQGRPHRRAVLLGGLGLGGAAAAAVGLAACGGSGGPT
PIPGPTLRAPTPVPGVTDGVFALGVASGDPLPDGVILWTRLAPRPSEGGGMPSRDVPVDW
QIAADENFRSVVRAGTQTAQAAFAHSVHVDVRGLEPGREYFYRFRAGTVLSPVGRTRTAA
APQADAAAAGGALTLALASCQDFQNGYWPAFDAIAADAPDLVVHVGDYIYEYDPDSRFPD
RVHTTPQQPGLDQLQTLADYRNRYGQYKADPALQAAHHAAPWVVTWDDHEVENNYAGLVD
EAGDSGDRHQDPAVFARQRAAAYQAYYEHMPIRVELNPGSPDLRIYRRLAFGGLLTLNVM
DTRQYRTPVPGNSPEAVGPAALGAGNIGGTMAGAAQERWLRAGLDASRTRWNVIAQQTMM
AQLDGQLPVGSGSMLTNLDQNDGYRPYRRRLLSGVRDSRARNPVVLSGDLHCAWVNDLRV
DFDRPETPAVATEFVCTSISSAFFLINDDFVRENNARLNPHVRYFRGDRRGYTRIRVTPT
EWRADMRVVADLSRRDSPVTTDATWVVEDGVPGARPA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
gtgaccggtgatgccacggcgggcccctctcgtccccttcgatctctgttcgccggcgcc
gcgtccaccccccagggtcgcccgcaccggcgggcggtcctgctcggtgggctggggctc
gggggcgcggcggcggccgcggtggggctggcggcgtgcggcggctcgggcggcccgacg
ccgatcccggggccgacgctgcgcgcgccgacccccgtcccaggggtgaccgacggggtg
ttcgccctgggggtggccagcggcgacccgctgcccgacggcgtcatcctgtggacccgg
ctggcgccgcgcccgagcgagggcggcgggatgccctcacgcgacgtcccggtcgactgg
cagatcgccgccgacgagaacttccgttcggtggtacgcgccggcacgcagaccgcgcag
gcggcgttcgcccactcggtgcacgtcgacgtccgcggtctggagccgggacgcgagtac
ttctaccgtttccgggccggcaccgtgctcagccccgtcggccgcaccaggaccgccgcc
gccccgcaggccgacgcggccgcggccgggggcgcgctgaccctggcgctggcctcctgc
caggacttccagaacggttactggccggccttcgacgccatcgccgcggacgcgccggac
ctcgtcgtgcacgtcggcgactacatctacgagtacgacccggacagccggttcccggac
cgcgtgcacaccaccccccagcagcccggactcgaccagctccagacgctggcggactat
cgcaaccgctacggccagtacaaggcggacccggccctgcaggcggcccaccacgccgcg
ccctgggtcgtcacctgggacgaccacgaggtcgagaacaactacgcggggctcgtcgac
gaggccggcgactccggcgaccgccatcaggacccggccgtcttcgcccgccagcgggcc
gccgcctaccaggcgtactacgagcacatgccgatccgggtcgaactcaacccgggctcc
cccgacctgcgcatctaccgccgcctcgccttcggcggcctgctgacgctcaacgtcatg
gacacccgccagtaccggaccccggtgccgggcaactcgccggaggccgtcggcccggcc
gcgctcggcgccggcaacatcggcggcacgatggccggggccgcccaggaacgctggctg
cgcgcggggctcgacgcctcccggacccgctggaacgtgatcgcgcagcagacgatgatg
gcccagctcgacggccagcttcccgtcgggtccgggagcatgctgaccaacctcgaccag
aacgacggttaccgcccctaccgccgacggctgctgtccggggtgcgcgacagccgggcg
cgcaatccggtggtgctctccggggacctccactgcgcctgggtgaacgacctgcgcgtc
gacttcgaccgaccggagacccccgcggtcgcgaccgagttcgtctgcacctcgatcagc
tcggccttcttcctcatcaacgacgacttcgtccgggagaacaacgcccgcctcaacccg
cacgtccgctacttccgcggtgatcgccgggggtacacccggatccgggtgacgccgacg
gaatggcgcgcggacatgcgggtcgtcgccgacctctcccggcgggactcgccggtcacc
accgacgccacctgggtcgtcgaggacggcgtccccggcgcccgacccgcctga

DBGET integrated database retrieval system