KEGG   Frankia alni: FRAAL6098Help
Entry
FRAAL6098         CDS       T00384                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fal  Frankia alni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRAAL6098 (folP)
Enzymes [BR:fal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     FRAAL6098 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6616737..6617702
Genome map
AA seq 321 aa AA seqDB search
MDADPPETTALTPRTPTAPTAPSPTDLPPLAPRQGPLRLGRRVFGPSELVVMAIVNRTPD
SFFDRGATYGEAAALDAVDRAVEDGAEIIDIGGVKAAPGGEVSPAEELRRVGGFVAAVRA
RHPDLVISVDTWRAAVGRVVAGEGADLLNDAWGGVDPQLAEVAAEFGTGLVCTHAGHLPP
RTRPHRMTYDDVVADIVTTTTGLAERAASLGVRADAVLIDPGHDFGKNSRHSLEATRRLP
ELAATGWPVLVAMSNKDFVGETLDTGVDERLEGTLAATAISAWLGARVFRAHQVAATLRT
LRMVAAIRGDADLAVARRGVV
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccgaccctcccgagacgaccgccctgacgccccgcaccccgaccgccccgacc
gccccgtcgccgaccgacctgccgcccctcgccccgcgacaggggccgctgcggctgggg
cgacgggtgttcggaccgtcggaactggtggtcatggccatcgtcaatcgcaccccggac
tcgttcttcgaccggggcgcgacgtacggggaggccgcggcgctcgacgccgtcgaccgt
gccgtcgaggacggggcggagatcatcgacatcggcggggtcaaggcggcccccggcggc
gaggtgagcccggccgaggagcttcgccgggtgggcggcttcgtcgccgcggtccgcgca
cgccatcccgacctggtgatcagcgtcgacacctggcgggcggcggtcggccgcgtggtc
gccggggagggcgccgacctgctcaacgacgcctggggcggggtggacccgcagctcgcc
gaggtcgccgccgagttcggcacgggcctggtctgcacccacgccgggcatctgccaccc
cggacccggccgcaccggatgacctacgacgacgtcgtcgccgacatcgtcaccacgacg
accggcctcgccgagcgcgccgcgtcgctgggggtgcgcgccgacgcggtgctcatcgac
ccgggccacgacttcggcaagaacagccggcactcgctggaggccacccggcggttgccg
gaactggcggccaccgggtggccggtgctcgtcgccatgtcgaacaaggacttcgtcggg
gagacgctggacaccggggtcgacgaacgcctggagggaaccctcgccgcgacggcgatc
agcgcctggctcggcgcccgggtcttccgcgcccaccaggtggccgcgacgctgcggacg
ctgcggatggtcgcggcgatccgcggcgacgccgaccttgccgtcgcccgccgcggcgtc
gtctga

DBGET integrated database retrieval system