KEGG   Frankia alni: FRAAL6118Help
Entry
FRAAL6118         CDS       T00384                                 

Definition
glycosyltransferase (EC:2.4.1.83)
Organism
fal  Frankia alni
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6643760..6644608
Genome map
AA seq 282 aa AA seqDB search
MSSTQHRPTVSVIIPTLNEARNLAHVFARLPADVEIVVVDGRSTDGTVEVARRLRPDVVI
VNQTRRGKGNALASGFAAATGSIIVMLDADGSADPGEIDAYVSALVLGADFAKGSRFCAG
GGSSDITRLRALGNRVLNGLVNLLIGSRYTDLCYGYNAFWRRCLPVLEMDPGPADSVKRW
GDGFEIETLINMRVALAGLRVVEVPSYEHHRIHGASNLNAVSDGIRVLRTIIVERRGKGR
LRPHATVLPHPLLEIPEQPQPRGAAGGPAAPVANPATQLESA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaacgcagcatcgacctaccgtgagcgtcatcattccgacgctgaatgaggcc
cgcaatctggcgcatgtcttcgcgcggctgcccgccgacgtggagatcgtggtcgtcgac
ggacgatcgacggacggaacggtggaggtcgcccgccgcctgcgcccggacgtggtcatc
gtgaaccagaccaggcgcgggaagggtaacgcgctggcctccgggttcgcggccgccacc
ggttcgatcatcgtgatgctggacgccgacggctcggccgacccgggcgagatcgacgcg
tacgtgtccgcgctcgtcctcggcgcggacttcgccaaggggtcgcgcttctgcgccggc
ggcggaagcagcgacatcaccaggctgcgcgcgctgggcaaccgggttctcaacggcctg
gtgaacctgctcatcggcagccgctacaccgacctgtgctacgggtacaacgcgttctgg
cgccggtgcctgcccgtcctcgaaatggacccgggcccggcggactcggtgaagcgctgg
ggcgacggattcgagatcgagaccctcatcaacatgcgggtcgccctcgccggcctgcgg
gtggtcgaggtgccgagctacgagcaccaccggatccacggcgccagcaacctcaacgcc
gtctccgacggtatccgggtgctgcgcacgatcatcgtcgagcggcgtggcaagggccgt
ctgcggccgcacgccaccgtccttccgcacccgctgctcgaaatccccgagcagccgcag
ccgcgaggcgctgccggcggtcccgccgcgccggtcgccaaccccgcgacgcagttggag
agcgcgtga

DBGET integrated database retrieval system