KEGG   Frankia alni: FRAAL6397Help
Entry
FRAAL6397         CDS       T00384                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase) (UDPGP) (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine diphosphoglucose pyrophosphorylase) (General stress protein 33) (GSP33)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fal  Frankia alni
Pathway
fal00040  Pentose and glucuronate interconversions
fal00052  Galactose metabolism
fal00500  Starch and sucrose metabolism
fal00520  Amino sugar and nucleotide sugar metabolism
fal01100  Metabolic pathways
fal01130  Biosynthesis of antibiotics
Module
fal_M00362  Nucleotide sugar biosynthesis, prokaryotes
fal_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FRAAL6397 (galU)
   00052 Galactose metabolism
    FRAAL6397 (galU)
   00500 Starch and sucrose metabolism
    FRAAL6397 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL6397 (galU)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FRAAL6397 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CAJ65020
RhizoBase: FRAAL6397
UniProt: Q0RC10
Position
complement(6948818..6949750)
Genome map
AA seq 310 aa AA seqDB search
MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEASRVGLRDVLLVTSRTK
KAIEDHFDREADIEAALERKGDETRLRRVRASAELAEVHSVRQPSPRGLGHAILCAAAHV
GDEPFAVLLGDDLIDERDPLLAEMLAVQARFGGSVIALMEVPREQVSMYGVATVESVPTG
PDDRYGIVRILDLVEKPPVAEAPSNLAIIGRYVLAPEIFEVLRRTEPGRGGEIQITDALR
TLALNAVAGGTDAQPVHGVVFTGRRYDTGDRIDYLKAVIRLACERADLGPDLYPWLEEYV
AAGGPKGNLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgaaggcggttattccggccgcgggtctgggcactcgcttcctgccggcc
accaaggcggtgcccaaggagatgctgccggtcgtcgacaggccggctatcgaatacgtc
gtcgaggaggcctcccgggtcggcctgcgcgacgtcctccttgtcaccagtcgtaccaag
aaggcgatcgaggaccattttgatcgagaggcggacatcgaggccgcgctcgaacgcaag
ggcgacgagacccgccttcgccgagtccgcgcgtcggcggagctggccgaggtgcactcg
gtccgccagccctcgccgcgggggctcggtcacgccatcctgtgcgcggccgcgcacgtg
ggcgacgagcccttcgccgtcctgctcggtgacgatctcatcgacgagcgcgacccgctg
ctggcggagatgctcgcggtgcaggcccgcttcggcggcagcgtcatcgcgctgatggag
gtcccgcgggagcaggtctcgatgtacggcgtcgccaccgtggagtccgtccccaccggg
ccggacgaccggtacgggatcgtgcgcatcctggacctggtggagaagccgccggtcgcg
gaggcgccgagcaacctggcgatcatcggccgctacgtcctggccccggagatcttcgag
gtgctgcggcgcaccgagcccgggcgaggcggggagatccagatcaccgacgcgctgcgg
acgctggcgctgaacgcggtggccgggggcacggacgcccagccggtgcacggcgtggtg
ttcacgggccggcgctacgacaccggggaccggatcgactacctcaaggcggtcatccgg
ctcgcctgcgagcgggcggatctgggccccgacctctatccgtggctcgaggagtacgtc
gccgccggcggacccaagggaaatttgtcctaa

DBGET integrated database retrieval system