KEGG   Frankia alni: FRAAL6397Help
Entry
FRAAL6397         CDS       T00384                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fal  Frankia alni
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FRAAL6397 (galU)
   00052 Galactose metabolism
    FRAAL6397 (galU)
   00500 Starch and sucrose metabolism
    FRAAL6397 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    FRAAL6397 (galU)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     FRAAL6397 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(6948818..6949750)
Genome map
AA seq 310 aa AA seqDB search
MPVTKAVIPAAGLGTRFLPATKAVPKEMLPVVDRPAIEYVVEEASRVGLRDVLLVTSRTK
KAIEDHFDREADIEAALERKGDETRLRRVRASAELAEVHSVRQPSPRGLGHAILCAAAHV
GDEPFAVLLGDDLIDERDPLLAEMLAVQARFGGSVIALMEVPREQVSMYGVATVESVPTG
PDDRYGIVRILDLVEKPPVAEAPSNLAIIGRYVLAPEIFEVLRRTEPGRGGEIQITDALR
TLALNAVAGGTDAQPVHGVVFTGRRYDTGDRIDYLKAVIRLACERADLGPDLYPWLEEYV
AAGGPKGNLS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgccagtgacgaaggcggttattccggccgcgggtctgggcactcgcttcctgccggcc
accaaggcggtgcccaaggagatgctgccggtcgtcgacaggccggctatcgaatacgtc
gtcgaggaggcctcccgggtcggcctgcgcgacgtcctccttgtcaccagtcgtaccaag
aaggcgatcgaggaccattttgatcgagaggcggacatcgaggccgcgctcgaacgcaag
ggcgacgagacccgccttcgccgagtccgcgcgtcggcggagctggccgaggtgcactcg
gtccgccagccctcgccgcgggggctcggtcacgccatcctgtgcgcggccgcgcacgtg
ggcgacgagcccttcgccgtcctgctcggtgacgatctcatcgacgagcgcgacccgctg
ctggcggagatgctcgcggtgcaggcccgcttcggcggcagcgtcatcgcgctgatggag
gtcccgcgggagcaggtctcgatgtacggcgtcgccaccgtggagtccgtccccaccggg
ccggacgaccggtacgggatcgtgcgcatcctggacctggtggagaagccgccggtcgcg
gaggcgccgagcaacctggcgatcatcggccgctacgtcctggccccggagatcttcgag
gtgctgcggcgcaccgagcccgggcgaggcggggagatccagatcaccgacgcgctgcgg
acgctggcgctgaacgcggtggccgggggcacggacgcccagccggtgcacggcgtggtg
ttcacgggccggcgctacgacaccggggaccggatcgactacctcaaggcggtcatccgg
ctcgcctgcgagcgggcggatctgggccccgacctctatccgtggctcgaggagtacgtc
gccgccggcggacccaagggaaatttgtcctaa

DBGET integrated database retrieval system