KEGG   Frankia alni: FRAAL6700Help
Entry
FRAAL6700         CDS       T00384                                 

Gene name
thrC-like
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fal  Frankia alni
Pathway
fal00260  Glycine, serine and threonine metabolism
fal00750  Vitamin B6 metabolism
fal01100  Metabolic pathways
fal01110  Biosynthesis of secondary metabolites
fal01120  Microbial metabolism in diverse environments
fal01230  Biosynthesis of amino acids
Module
fal_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL6700 (thrC-like)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FRAAL6700 (thrC-like)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FRAAL6700 (thrC-like)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP MmgE_PrpD MerR ETF
Motif
Other DBs
NCBI-ProteinID: CAJ65323
RhizoBase: FRAAL6700
UniProt: Q0RB65
Position
7305466..7306758
Genome map
AA seq 430 aa AA seqDB search
MRSFFMTLAPERADTPALDVANPAVGLSCRHCGATYPLSPSHVCVECFAPLEISYDPDLL
GRVTRESIERGPANLWRYVGLLPAGHDPARRVSLGAGWTPLRPAPRLAAELGMKTLYVKD
DSANPTHSFKDRVVSVALSAARELGFTTVACASTGNLAQSVAAHAAGAGLRSVVLVPHDL
EAGKTVSTGVYGGTLVAIQGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEV
AEQLGWRLPEQVVVPIASGSLLTKVDKAFGELGKLGLVEPTPYRVFGAQAAGCNPVAAAF
ARGVDTVAPVRPSTIAKSLSIGNPADGPYALDVARRTGGAITDVSDDEILEGMRLLARTE
GIFGETAGGVTVANLRRLLREGLLDPAAETVIYNTGDGLKTLDPLVETGGPTATIKPSLR
AFEAAGLGDD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcttcttcatgactctcgcgcccgagcgtgccgacactcccgccctcgacgtc
gcgaaccccgcggtcggactgtcctgtcgccactgcggcgccacctaccccctctccccg
tcccacgtgtgcgtggagtgcttcgccccgctggagatctcctacgaccccgacctgctc
ggccgggtcacccgggagtccatcgagcgtgggccggccaacctgtggcgctacgtcggc
ctgctgcccgcggggcacgacccggcgcgccgggtgtcgctcggcgccggctggacgccg
ctgcgcccggccccgcgcctggccgccgagctggggatgaagaccctctacgtcaaggac
gacagcgccaacccgacgcactcgttcaaggaccgcgtcgtctcggtggcgctgagcgcc
gcccgcgagctcggcttcaccacggtggcctgcgcctcgaccggcaacctcgcccagtcc
gtggccgcgcacgccgccggggccgggctgcgctcggtggtgctggtgccgcacgacctg
gaggccggcaagaccgtctccaccggcgtgtacggcgggaccctcgtcgcgatccagggc
aactacgacgatgtcaaccggctgtgcagcgagctggccggcgagtacgagtgggcgttc
gtcaacgtcaacgtccgcccgttctacgccgagggctccaagacgctgggttacgaggtc
gccgagcagctcggctggcggcttcccgagcaggtcgtcgtgccgatcgcgtccggctcc
ctgctgaccaaggtcgacaaggcgttcggcgagctcggcaagctgggcctggtggagccg
acgccgtaccgggtcttcggcgcgcaggccgccggctgcaacccggtggccgcggcgttc
gcccgcggggtcgacacggttgccccggtgcgaccgtcgacgatcgccaagtcgctgtcc
atcggcaacccggccgacggcccgtacgccctcgacgtcgcccgccgcaccggcggtgcg
atcacggacgtcagcgacgacgagatcctcgagggcatgcggctgctggcccgtaccgag
ggcatcttcggcgagaccgccggcggcgtcacggtcgcgaacctgcgccgcctgctgcgc
gagggtctgctcgacccggccgccgagaccgtcatctacaacaccggcgacgggctgaag
accctcgacccgctggtcgagaccggcggcccgacggccaccatcaagccgtcgctgcgt
gccttcgaggccgccggcctcggcgacgactga

DBGET integrated database retrieval system