KEGG   Frankia alni: FRAAL6700Help
Entry
FRAAL6700         CDS       T00384                                 

Gene name
thrC-like
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fal  Frankia alni
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    FRAAL6700 (thrC-like)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FRAAL6700 (thrC-like)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FRAAL6700 (thrC-like)
Enzymes [BR:fal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FRAAL6700 (thrC-like)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
7305466..7306758
Genome map
AA seq 430 aa AA seqDB search
MRSFFMTLAPERADTPALDVANPAVGLSCRHCGATYPLSPSHVCVECFAPLEISYDPDLL
GRVTRESIERGPANLWRYVGLLPAGHDPARRVSLGAGWTPLRPAPRLAAELGMKTLYVKD
DSANPTHSFKDRVVSVALSAARELGFTTVACASTGNLAQSVAAHAAGAGLRSVVLVPHDL
EAGKTVSTGVYGGTLVAIQGNYDDVNRLCSELAGEYEWAFVNVNVRPFYAEGSKTLGYEV
AEQLGWRLPEQVVVPIASGSLLTKVDKAFGELGKLGLVEPTPYRVFGAQAAGCNPVAAAF
ARGVDTVAPVRPSTIAKSLSIGNPADGPYALDVARRTGGAITDVSDDEILEGMRLLARTE
GIFGETAGGVTVANLRRLLREGLLDPAAETVIYNTGDGLKTLDPLVETGGPTATIKPSLR
AFEAAGLGDD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaggagcttcttcatgactctcgcgcccgagcgtgccgacactcccgccctcgacgtc
gcgaaccccgcggtcggactgtcctgtcgccactgcggcgccacctaccccctctccccg
tcccacgtgtgcgtggagtgcttcgccccgctggagatctcctacgaccccgacctgctc
ggccgggtcacccgggagtccatcgagcgtgggccggccaacctgtggcgctacgtcggc
ctgctgcccgcggggcacgacccggcgcgccgggtgtcgctcggcgccggctggacgccg
ctgcgcccggccccgcgcctggccgccgagctggggatgaagaccctctacgtcaaggac
gacagcgccaacccgacgcactcgttcaaggaccgcgtcgtctcggtggcgctgagcgcc
gcccgcgagctcggcttcaccacggtggcctgcgcctcgaccggcaacctcgcccagtcc
gtggccgcgcacgccgccggggccgggctgcgctcggtggtgctggtgccgcacgacctg
gaggccggcaagaccgtctccaccggcgtgtacggcgggaccctcgtcgcgatccagggc
aactacgacgatgtcaaccggctgtgcagcgagctggccggcgagtacgagtgggcgttc
gtcaacgtcaacgtccgcccgttctacgccgagggctccaagacgctgggttacgaggtc
gccgagcagctcggctggcggcttcccgagcaggtcgtcgtgccgatcgcgtccggctcc
ctgctgaccaaggtcgacaaggcgttcggcgagctcggcaagctgggcctggtggagccg
acgccgtaccgggtcttcggcgcgcaggccgccggctgcaacccggtggccgcggcgttc
gcccgcggggtcgacacggttgccccggtgcgaccgtcgacgatcgccaagtcgctgtcc
atcggcaacccggccgacggcccgtacgccctcgacgtcgcccgccgcaccggcggtgcg
atcacggacgtcagcgacgacgagatcctcgagggcatgcggctgctggcccgtaccgag
ggcatcttcggcgagaccgccggcggcgtcacggtcgcgaacctgcgccgcctgctgcgc
gagggtctgctcgacccggccgccgagaccgtcatctacaacaccggcgacgggctgaag
accctcgacccgctggtcgagaccggcggcccgacggccaccatcaagccgtcgctgcgt
gccttcgaggccgccggcctcggcgacgactga

DBGET integrated database retrieval system