KEGG   Frankia alni: FRAAL6708Help
Entry
FRAAL6708         CDS       T00384                                 

Gene name
folK
Definition
hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fal  Frankia alni
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRAAL6708 (folK)
Enzymes [BR:fal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     FRAAL6708 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7318197..7318829)
Genome map
AA seq 210 aa AA seqDB search
MAADPMAADPMAEAAHAVLALGSNLGDRWALLRAAVRQLDELLGVRACSSVYETDPVGGP
EQDDYLNAVVLTAPAPPRELLAAVRAVEERARRTRTLRWGPRTLDVDVIALGTLHSDDPE
IIIPHPRAHLRAFVCVPWLDVDPEATLPDHGRVADLVARMASAGELAGLRRASGRLGPDP
SGPDPSGPDPSGTARTSTSAGELGAGGASA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgacccgatggccgctgacccgatggccgaggccgcccacgcggtgctggcg
ctcggctcgaacctgggtgaccgctgggcgctgctgcgggccgccgtgcgccagctcgac
gagctcctcggcgtgagggcatgctcgtcggtgtacgagaccgaccccgtgggcggtccc
gagcaggacgactacctcaacgcggtcgtgctgacggcgccggcgccaccgcgggagctg
ctggctgccgtgcgtgccgtcgaggagcgggcgcggcggacgcggaccctgcggtggggg
ccgcgcacgctcgacgtggacgtgatcgccctcggcacgctgcacagcgacgacccagag
atcatcatcccgcacccgcgggcgcacctgcgggccttcgtctgcgttccctggctggac
gtcgaccccgaggcgaccctgccggatcacggccgggtcgcggacctggtcgccaggatg
gcgagcgccggggagctcgccggcctgcggcgggcctccggccggctcggccccgatccg
tccggccccgatccgtccggccccgatccgtccggcaccgccaggacgtccacctcggcc
ggggagctcggtgcaggcggtgcgtcggcgtga

DBGET integrated database retrieval system