KEGG   Frankia alni: FRAAL6708Help
Entry
FRAAL6708         CDS       T00384                                 

Gene name
folK
Definition
hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fal  Frankia alni
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fal00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7318197..7318829)
Genome map
AA seq 210 aa AA seqDB search
MAADPMAADPMAEAAHAVLALGSNLGDRWALLRAAVRQLDELLGVRACSSVYETDPVGGP
EQDDYLNAVVLTAPAPPRELLAAVRAVEERARRTRTLRWGPRTLDVDVIALGTLHSDDPE
IIIPHPRAHLRAFVCVPWLDVDPEATLPDHGRVADLVARMASAGELAGLRRASGRLGPDP
SGPDPSGPDPSGTARTSTSAGELGAGGASA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggccgctgacccgatggccgctgacccgatggccgaggccgcccacgcggtgctggcg
ctcggctcgaacctgggtgaccgctgggcgctgctgcgggccgccgtgcgccagctcgac
gagctcctcggcgtgagggcatgctcgtcggtgtacgagaccgaccccgtgggcggtccc
gagcaggacgactacctcaacgcggtcgtgctgacggcgccggcgccaccgcgggagctg
ctggctgccgtgcgtgccgtcgaggagcgggcgcggcggacgcggaccctgcggtggggg
ccgcgcacgctcgacgtggacgtgatcgccctcggcacgctgcacagcgacgacccagag
atcatcatcccgcacccgcgggcgcacctgcgggccttcgtctgcgttccctggctggac
gtcgaccccgaggcgaccctgccggatcacggccgggtcgcggacctggtcgccaggatg
gcgagcgccggggagctcgccggcctgcggcgggcctccggccggctcggccccgatccg
tccggccccgatccgtccggccccgatccgtccggcaccgccaggacgtccacctcggcc
ggggagctcggtgcaggcggtgcgtcggcgtga

DBGET integrated database retrieval system