KEGG   Frankia alni: FRAAL6768Help
Entry
FRAAL6768         CDS       T00384                                 

Gene name
choA
Definition
cholesterol-O2 oxidoreductase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fal  Frankia alni
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:fal00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    FRAAL6768 (choA)
Enzymes [BR:fal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     FRAAL6768 (choA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7373887..7375578)
Genome map
AA seq 563 aa AA seqDB search
MVGSGFGGSVSALRLVEKGYRVLVVEAGRRFSPRTLPRNNWHIRRFLWLPRLGCHGIQKI
TWLGRVIVLSGTAVGGGSVVYANTLYRPLDAFYADPQWRGITDWRAELAPFFEQAERMLG
VTANPTTTYADEVFHAVADEMGVGPSFAPARVGVFFGRDGRQEPGVRVPDPYFGGVGPGR
TGCVECGECMTGCRRGAKNTLDRNYLFLAERAGARVLPDTTVTAIRPRPGGGYEVDVART
PGMPRRGRRTLTAGQVVLAAGTLGTQRLLLSARERGDLPALSPRLGELTRTNSESILGAT
RFRPDRRVARGVAITSSFYPDGQTHVEPVRYGRGSNLMALISAAMTDGGGRAPRWLKYLR
ELLVRPHHALAMGLPWRWSERTMIALVMQARDNSLTVSLRRGPFGLRWLTSRQGHGDPNP
SWIPAGNEAVRRIAARIGGYPGGSVGEIADIPMTAHILGGAPIGADPSTGVIDPYQRVFG
YAGLHVADGAAISANLGANPSLTITAQAERAMSFWPNKGEADPRPTMGQPYRRVDPRAPA
RPAVPADAPGAYRIGDPAAAPRR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcagtggcttcggcggcagcgtcagcgcgttgcgcctcgtggagaagggctac
cgggtcctcgtcgtcgaggcgggtcgccggttcagcccgcggacgctgccgcgcaacaac
tggcacatccgccggttcctgtggctgccgcggctggggtgccacggcatccagaagatc
acttggctgggtcgggtcatcgtgctgtccgggacggcggtcggcggcggatcggtcgtc
tacgcgaacaccctgtaccgaccgctcgacgccttctacgccgacccgcagtggcgcggc
atcaccgactggcgggccgagctggccccgttcttcgagcaggccgagcggatgctcggg
gtgaccgcgaatccgacgaccacgtacgccgacgaggtgttccacgcggtggcggacgag
atgggcgtcgggccgagcttcgccccggcgcgggtcggggtcttcttcggccgcgacggc
cggcaggagccgggagtccgggtacccgacccctacttcggcggggtcgggcccggccgc
acgggttgcgtcgaatgcggcgagtgcatgaccggctgccgccgcggagcgaagaacacg
ctggaccgcaactacctgttcctcgccgagcgggccggcgcgcgggtcctgcccgacacc
accgtcaccgccatccgcccgcggcccggcggcgggtacgaggtcgacgtcgcccggacg
ccggggatgccccggcgcgggcggcgcacgctgaccgcggggcaggtcgtgctggccgcc
ggcaccctcgggacccagcgtctgttgctctcggcgcgcgagcgcggggacctgcccgcc
ctgtccccccggctcggcgagctcacccggacgaactccgagtcgatcctcggcgcgacg
cggttccgcccggaccgccgggtcgcccgcggagtggcgatcacgtcgtcgttctacccg
gacgggcagacccacgtcgaaccggtccgctacggccggggcagcaacctgatggccctg
atcagcgcggcgatgacggacggcgggggccgggcgccgcggtggctgaagtacctgcgg
gaactactggtccgcccgcaccacgcactggccatggggctgccctggcgctggtccgaa
cggaccatgatcgctctggtgatgcaggcgcgcgacaactcgctgacggtgtcgctgcgg
cgcggcccgttcggtcttcgctggctgacgagccggcagggccacggcgatccgaacccg
tcgtggatcccggcgggcaacgaggccgtccgccggatcgcagcccggatcggcggctac
cccggtggctccgtcggggagatcgccgacatcccgatgaccgcgcacatcctcggcggc
gccccgatcggcgcggacccgtccaccggcgtgatcgacccctaccagcgggtcttcggc
tatgcgggcctgcacgtggccgacggcgcggcgatctcggcgaatctcggggcgaacccg
tcgctgaccatcaccgcccaggccgaacgggccatgtcgttctggccgaacaagggcgaa
gcggacccccgtccgacgatgggccagccctaccggcgggtcgatccccgcgcgccggcc
cgaccggccgttccggcggacgcccccggcgcgtaccgcatcggcgatccggccgcggcg
ccgcgccgttga

DBGET integrated database retrieval system