KEGG   Frankia alni: FRAAL6768Help
Entry
FRAAL6768         CDS       T00384                                 

Gene name
choA
Definition
cholesterol-O2 oxidoreductase (EC:1.1.3.6)
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
fal  Frankia alni
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:fal00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(7373887..7375578)
Genome map
AA seq 563 aa AA seqDB search
MVGSGFGGSVSALRLVEKGYRVLVVEAGRRFSPRTLPRNNWHIRRFLWLPRLGCHGIQKI
TWLGRVIVLSGTAVGGGSVVYANTLYRPLDAFYADPQWRGITDWRAELAPFFEQAERMLG
VTANPTTTYADEVFHAVADEMGVGPSFAPARVGVFFGRDGRQEPGVRVPDPYFGGVGPGR
TGCVECGECMTGCRRGAKNTLDRNYLFLAERAGARVLPDTTVTAIRPRPGGGYEVDVART
PGMPRRGRRTLTAGQVVLAAGTLGTQRLLLSARERGDLPALSPRLGELTRTNSESILGAT
RFRPDRRVARGVAITSSFYPDGQTHVEPVRYGRGSNLMALISAAMTDGGGRAPRWLKYLR
ELLVRPHHALAMGLPWRWSERTMIALVMQARDNSLTVSLRRGPFGLRWLTSRQGHGDPNP
SWIPAGNEAVRRIAARIGGYPGGSVGEIADIPMTAHILGGAPIGADPSTGVIDPYQRVFG
YAGLHVADGAAISANLGANPSLTITAQAERAMSFWPNKGEADPRPTMGQPYRRVDPRAPA
RPAVPADAPGAYRIGDPAAAPRR
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggcagtggcttcggcggcagcgtcagcgcgttgcgcctcgtggagaagggctac
cgggtcctcgtcgtcgaggcgggtcgccggttcagcccgcggacgctgccgcgcaacaac
tggcacatccgccggttcctgtggctgccgcggctggggtgccacggcatccagaagatc
acttggctgggtcgggtcatcgtgctgtccgggacggcggtcggcggcggatcggtcgtc
tacgcgaacaccctgtaccgaccgctcgacgccttctacgccgacccgcagtggcgcggc
atcaccgactggcgggccgagctggccccgttcttcgagcaggccgagcggatgctcggg
gtgaccgcgaatccgacgaccacgtacgccgacgaggtgttccacgcggtggcggacgag
atgggcgtcgggccgagcttcgccccggcgcgggtcggggtcttcttcggccgcgacggc
cggcaggagccgggagtccgggtacccgacccctacttcggcggggtcgggcccggccgc
acgggttgcgtcgaatgcggcgagtgcatgaccggctgccgccgcggagcgaagaacacg
ctggaccgcaactacctgttcctcgccgagcgggccggcgcgcgggtcctgcccgacacc
accgtcaccgccatccgcccgcggcccggcggcgggtacgaggtcgacgtcgcccggacg
ccggggatgccccggcgcgggcggcgcacgctgaccgcggggcaggtcgtgctggccgcc
ggcaccctcgggacccagcgtctgttgctctcggcgcgcgagcgcggggacctgcccgcc
ctgtccccccggctcggcgagctcacccggacgaactccgagtcgatcctcggcgcgacg
cggttccgcccggaccgccgggtcgcccgcggagtggcgatcacgtcgtcgttctacccg
gacgggcagacccacgtcgaaccggtccgctacggccggggcagcaacctgatggccctg
atcagcgcggcgatgacggacggcgggggccgggcgccgcggtggctgaagtacctgcgg
gaactactggtccgcccgcaccacgcactggccatggggctgccctggcgctggtccgaa
cggaccatgatcgctctggtgatgcaggcgcgcgacaactcgctgacggtgtcgctgcgg
cgcggcccgttcggtcttcgctggctgacgagccggcagggccacggcgatccgaacccg
tcgtggatcccggcgggcaacgaggccgtccgccggatcgcagcccggatcggcggctac
cccggtggctccgtcggggagatcgccgacatcccgatgaccgcgcacatcctcggcggc
gccccgatcggcgcggacccgtccaccggcgtgatcgacccctaccagcgggtcttcggc
tatgcgggcctgcacgtggccgacggcgcggcgatctcggcgaatctcggggcgaacccg
tcgctgaccatcaccgcccaggccgaacgggccatgtcgttctggccgaacaagggcgaa
gcggacccccgtccgacgatgggccagccctaccggcgggtcgatccccgcgcgccggcc
cgaccggccgttccggcggacgcccccggcgcgtaccgcatcggcgatccggccgcggcg
ccgcgccgttga

DBGET integrated database retrieval system