KEGG   Frateuria aurantia: Fraau_0073Help
Entry
Fraau_0073        CDS       T01773                                 

Definition
galactose mutarotase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fau00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fau00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
83304..84464
Genome map
AA seq 386 aa AA seqDB search
MKPKTAYLSRNSRWALAIAMSLGLYAQAQAAEGIQVQSWGSSRHGQAVSQYTLTNADGMV
VKFISYGGILTDIEVPDRHGNKANVLLGFANLKDYESYNGDIHFGALIGRYANRIAKGRF
SLDGKDYQLEINNPPNTLHSGFHTFDDKVWTVKPLQLKDAVGAELSYVSPDGENGFPGRL
TTHVRYILDNHNALHIQYQATTDKDTVLNLTNHSYFNLGGEGSGSVENEQVQIFASHYTP
TDATSIPTGEVASVAGTPLDFRQPTVIAKGLRSSDPQLVWAHGYDNNLVLDHPVSATPAL
AARVYDPASGRQLELFTTQPGLQFYTANGLNGGVVGSTGKTYRQGDAFAMEAEHFPDSPN
HPQFPSTELKPGQIFRQETVLSFSTR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaaaaccgcttatctttcccgcaacagccgctgggctcttgccatcgccatg
tcgctaggcctgtatgcccaggcacaagccgccgaaggtattcaggtgcagtcctggggc
agcagccgtcatggccaggccgtcagccagtacaccctgaccaatgccgatggcatggtg
gtgaagttcatcagctatggcggcatcctcaccgacatcgaggttccggaccggcacggc
aacaaggccaatgtgctgctgggctttgccaatctcaaggattacgagtcctacaacggg
gatatccactttggcgcgctgatcggccgttatgccaatcgcatcgccaaggggcgattc
agtctggacggcaaggactatcagctggaaatcaacaatccgccgaataccttgcacagc
ggtttccataccttcgatgacaaggtctggacggtgaagccgctgcagctcaaggatgca
gtcggtgccgagctgagctatgtcagtccggacggcgaaaacggtttcccgggcaggctg
accacccatgtccgctatattctggacaaccacaacgccctgcacatccagtaccaggcc
acgaccgacaaggacactgtcctgaacctgaccaaccacagctatttcaatctggggggc
gaaggttcgggcagcgtggaaaacgagcaggtacagatcttcgcttcgcattacacgccg
acggatgccacctcgatccccaccggcgaggttgcctcggtcgccggcacaccgctggat
ttccgtcagccgacggtgattgccaaaggcttgcgttcttcggatccgcagttggtctgg
gcccacggctatgacaacaatctggtgctggatcacccggtttcagcgactccagccttg
gctgcacgcgtctatgatccggccagcggccgccagctggagttgttcacgacccagccc
ggcctgcagttctatacggccaacggcttgaatggcggtgtggtcggcagtaccggcaag
acctatcggcagggcgatgccttcgcgatggaggccgagcactttcccgactcgcccaac
catccgcagtttccaagcaccgagctgaagcccggacagatcttccggcaggaaaccgtg
ctcagtttctccactcgctga

DBGET integrated database retrieval system