KEGG   Frateuria aurantia: Fraau_0089Help
Entry
Fraau_0089        CDS       T01773                                 

Definition
phosphoglycerate mutase, BPG-dependent, family 1
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_0089
   01230 Biosynthesis of amino acids
    Fraau_0089
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_0089
  Energy metabolism
   00680 Methane metabolism
    Fraau_0089
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fraau_0089
Enzymes [BR:fau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Fraau_0089
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Fraau_0089
  Exosomal proteins of melanoma cells
   Fraau_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
97549..98295
Genome map
AA seq 248 aa AA seqDB search
MHKLVLIRHGQSQWNLENRFSGWADIDLTEQGVAEAREAGQLLKQAGFSFDLAHTSRLTR
AVRTLWHVQDEMDAMWIPVVTDWRLNERHYGGLTGLNKAETAARFGDEQVKIWRRSYDTP
PPPQDRAENPAVGDPRYADLAPEQIPDTECLKDTVERVLPYWHESLAPAIKAGRKVVVAA
HGNSLRALVKYLDNISDEDIVELNIPNGVPLVYEFDDELRPLRHYYLGDAEAIAAKLAAV
ANQGKAKA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctagtcctgatccgccacggccagtcgcagtggaatcttgaaaaccgcttc
agtggctgggccgatatcgacctgaccgagcaaggcgtcgccgaggccagggaggctgga
caactgctgaagcaggccggtttcagtttcgatctggcccatacctcgcgactgacccgg
gccgtgcgcaccttgtggcatgtgcaggacgaaatggatgcgatgtggattccggtcgtc
accgactggcgcttgaacgaacgccactacggcggccttaccggcctcaacaaggccgag
acggcggccaggttcggtgacgagcaggtcaagatctggcggcgcagctatgacacgccg
ccgccgccccaggaccgtgcggagaatcccgccgttggtgatccgcgctacgccgatctg
gcaccggaacagattcccgataccgagtgcctgaaagacaccgtcgagcgcgtgctgccg
tactggcacgaaagcctggcgccggcgatcaaggccggccgcaaggtggtggtcgcggcc
cacggcaattcgctgcgggccctggtgaagtatctggacaacatctccgacgaggatatc
gtcgagctgaacattcccaacggcgtgcctctggtctacgaattcgatgacgaactcaga
cccttgcgccactactatctgggggatgccgaggcgatcgcggccaagctggcggccgtg
gccaaccaaggcaaggccaaggcctga

DBGET integrated database retrieval system