KEGG   Frateuria aurantia: Fraau_0095Help
Entry
Fraau_0095        CDS       T01773                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
fau  Frateuria aurantia
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_0095
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_0095
Enzymes [BR:fau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Fraau_0095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(103956..105260)
Genome map
AA seq 434 aa AA seqDB search
MSQIHATAAELNQAWSTDPRWKGIVRNYSAEDVLRLRGTVHVEHSLARRGAERLWKSLHE
EDFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLAGEMYPDQSLYPANSVPQVVK
RINNTLLRADQLQHAEGKDGTDWLVPIVADAEAGFGGVLNAFELMKAMIEAGAAGVHFED
QLASVKKCGHMGGKVLVPTREAIDKLTAARLAADVSGVPTILVARTDADAADLLTADIDD
NDRPFITGERTVEGFFRVRPGVDQAISRGLAYAPYADLLWCETSKPNLEDARKFAEAIHK
QFPGKLLAYNCSPSFNWRKNLDDATIARFQKELGAMGYKFQFITLAGFHSLNYGMFDLAY
GYARHQMSAFVELQEKEFAAAERGFTAVKHQREVGTGYFDAVTQTIQQGQSSTTALTGST
EEAQFDHDGTEKAA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagccagatccatgccactgccgccgagctgaaccaagcctggtcaaccgatccccgc
tggaaaggcattgtccgcaactacagcgccgaggatgtgctgcgcctgcgcggcaccgtc
catgtcgagcattcgctggcccgccgcggcgccgagcggttgtggaagtcgctgcacgaa
gaagacttcgtcaatgctctcggcgccctgaccggcaaccaggcgatgcagcaggtcaag
gcaggcctgaaggccatttatctgtccggctggcaggtcgccgccgatgccaatctggct
ggagagatgtatcccgaccagtcgctgtatccggccaattcagtgccccaggtggtcaag
cgcatcaacaataccttgctgcgtgccgaccagctgcagcatgccgaaggcaaggacggc
accgactggctggtgcccatcgtcgccgatgccgaggccggctttggcggggtgctgaat
gccttcgaactgatgaaggcgatgattgaagccggtgccgccggcgtccacttcgaggat
cagctggcctcggtcaagaagtgcggccacatgggcggcaaggtgctggtgccgacccgc
gaggccatcgacaagctgaccgccgcccggctggccgccgatgtcagcggcgtgccgacc
atcctggtggctcgcaccgacgccgatgccgccgatctgctgacggccgacatcgacgac
aacgaccgtcccttcatcaccggcgagcgtaccgtggagggctttttccgggtccgccca
ggcgtcgaccaggccatcagccgcggtctggcctatgccccctatgccgacctgctgtgg
tgcgaaaccagcaagccgaacctggaagatgcccgcaagttcgccgaggccatccacaag
cagttccccggcaagctgctggcctacaactgctcgcccagcttcaactggcgcaagaat
ctggacgatgccaccatcgcccgcttccagaaggaactgggcgcgatgggctacaagttc
cagttcatcaccctggccggtttccatagcctgaactacggcatgttcgacctggcctac
ggctacgcccgccatcagatgagcgccttcgtggagctgcaggaaaaggaattcgccgct
gccgagcgtggcttcaccgccgtcaagcaccagcgcgaagtgggtaccggctatttcgac
gccgtcactcagaccatccagcaaggtcagtcttcgaccacggcgctgaccggctcgacc
gaagaagcccagttcgatcacgacggcactgaaaaggccgcctga

DBGET integrated database retrieval system