KEGG   Frateuria aurantia: Fraau_0096Help
Entry
Fraau_0096        CDS       T01773                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fau  Frateuria aurantia
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_0096
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fraau_0096
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_0096
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fraau_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105316..106929)
Genome map
AA seq 537 aa AA seqDB search
MVASPAYPASTGPHLDCDPAPGHEDLLTAEARQFLSQLHQRFEPRRQALLQARRQQQAQF
DAGALPGFRADTLAIREGDWQVAPIPDELQDRRVEITGPVDRKMIINALNSGAKVFMADF
EDSNAPTWTNQLEGQQHLRAATAGTLDFDTPEGKSYRVGPAPALLMVRPRGWHLPEEHVR
VDGEIFSGALFDFGLYAFHNAGQLLQQRRGPYFYLPKLQAMEEAALWDEVLSFAEAFLEL
PIGSFKVTVLIETLPAVFQMHEILHALRRRIVGLNCGRWDYIFSYLKTLRAHPDRLLPER
SQVGMGVPFLKAYSELLIKTCHQRGALAMGGMAAQIPIKGDEQANQAALDKVRADKLREV
QAGHDGTWVAHPALVPIAAEIFDTYMPGPNQLGQLRLDVQVSAEQLLAVPAGDISRDGFE
NSIEVCLRYTAAWLAGQGCVPIHHLMEDAATAEISRAQLWQWLHYPVTSGQPPLQLSDGS
NIDFSLFDQVLEANRQALATSQWPGAAKADAAAELLATLSHAPQLTDFLTLPAYRQL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcatcacccgcgtatccggcaagcacaggacctcatcttgactgcgatccggcg
cccggccatgaagatctgctgactgccgaagcacggcaattcctgagccagctgcatcag
cggttcgagcctcgccggcaggccctgttgcaagccaggcggcaacaacaggcccaattc
gatgccggggccctgcccggctttcgtgccgacacgctggccatccgcgaaggcgactgg
caggtagcgccgattccggacgaactgcaggaccggcgagtagagatcaccggtccggtc
gatcgcaagatgatcatcaatgcactcaattcaggtgccaaagtgttcatggccgacttc
gaggactccaacgccccgacctggaccaatcagctggaaggccagcagcatctgcgtgcg
gccaccgccggcaccctggattttgacacccctgaaggcaagtcctatcgggtcggccct
gccccggccttgctgatggtgcgcccacgtggctggcatcttcccgaggagcatgtgcgc
gtcgatggcgaaatcttttccggcgccctgttcgatttcggcctgtacgccttccacaat
gccggccagctgttgcagcagcggcgaggtccctatttctacctgcccaagctgcaggcc
atggaagaggccgcgttatgggatgaggtgctgagctttgccgaagcgtttctggagctt
ccgatcggcagcttcaaggtcaccgtgctgatcgagaccctgccggccgtgttccagatg
cacgagatcctgcatgccctgcgccgacgcatcgtcggcctcaattgcgggcgctgggat
tacatcttctcgtatctgaaaaccctgcgcgcccacccggaccgactgctgccggagcgg
agccaggtcggcatgggcgtgccgttcctgaaggcctattccgaactgctgatcaagacc
tgccaccagcgcggcgcgctggccatgggaggaatggccgcccagattccgatcaagggt
gatgagcaggccaaccaggcggcgctggacaaggtacgcgccgacaagttgcgcgaagtg
caggccggtcacgacggcacctgggtcgcccatccggcactggtcccgattgctgccgaa
atattcgacacctatatgccaggccccaatcagctgggccagctacggctggatgtgcag
gtcagcgccgagcagctgctggccgtcccggcaggtgacatcagccgggatggcttcgag
aacagcatcgaggtctgtctgcgctataccgccgcctggctggccggtcagggctgcgtg
cccatccaccacctgatggaagacgccgccaccgccgaaatttcgcgcgcccagctgtgg
caatggttgcactacccggtcacctcgggtcagccaccactgcagctgagcgacggcagc
aacatcgacttcagcttgttcgaccaggtgctggaagccaatcggcaggcactggccacc
agccaatggccgggtgccgccaaggccgatgccgccgccgaactgctggccacgctgagc
catgccccccaattgaccgacttcctcaccctgccggcctatcgccagctgtga

DBGET integrated database retrieval system