KEGG   Frateuria aurantia: Fraau_0096Help
Entry
Fraau_0096        CDS       T01773                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fau  Frateuria aurantia
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_0096
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fraau_0096
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_0096
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fraau_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(105316..106929)
Genome map
AA seq 537 aa AA seqDB search
MVASPAYPASTGPHLDCDPAPGHEDLLTAEARQFLSQLHQRFEPRRQALLQARRQQQAQF
DAGALPGFRADTLAIREGDWQVAPIPDELQDRRVEITGPVDRKMIINALNSGAKVFMADF
EDSNAPTWTNQLEGQQHLRAATAGTLDFDTPEGKSYRVGPAPALLMVRPRGWHLPEEHVR
VDGEIFSGALFDFGLYAFHNAGQLLQQRRGPYFYLPKLQAMEEAALWDEVLSFAEAFLEL
PIGSFKVTVLIETLPAVFQMHEILHALRRRIVGLNCGRWDYIFSYLKTLRAHPDRLLPER
SQVGMGVPFLKAYSELLIKTCHQRGALAMGGMAAQIPIKGDEQANQAALDKVRADKLREV
QAGHDGTWVAHPALVPIAAEIFDTYMPGPNQLGQLRLDVQVSAEQLLAVPAGDISRDGFE
NSIEVCLRYTAAWLAGQGCVPIHHLMEDAATAEISRAQLWQWLHYPVTSGQPPLQLSDGS
NIDFSLFDQVLEANRQALATSQWPGAAKADAAAELLATLSHAPQLTDFLTLPAYRQL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcatcacccgcgtatccggcaagcacaggacctcatcttgactgcgatccggcg
cccggccatgaagatctgctgactgccgaagcacggcaattcctgagccagctgcatcag
cggttcgagcctcgccggcaggccctgttgcaagccaggcggcaacaacaggcccaattc
gatgccggggccctgcccggctttcgtgccgacacgctggccatccgcgaaggcgactgg
caggtagcgccgattccggacgaactgcaggaccggcgagtagagatcaccggtccggtc
gatcgcaagatgatcatcaatgcactcaattcaggtgccaaagtgttcatggccgacttc
gaggactccaacgccccgacctggaccaatcagctggaaggccagcagcatctgcgtgcg
gccaccgccggcaccctggattttgacacccctgaaggcaagtcctatcgggtcggccct
gccccggccttgctgatggtgcgcccacgtggctggcatcttcccgaggagcatgtgcgc
gtcgatggcgaaatcttttccggcgccctgttcgatttcggcctgtacgccttccacaat
gccggccagctgttgcagcagcggcgaggtccctatttctacctgcccaagctgcaggcc
atggaagaggccgcgttatgggatgaggtgctgagctttgccgaagcgtttctggagctt
ccgatcggcagcttcaaggtcaccgtgctgatcgagaccctgccggccgtgttccagatg
cacgagatcctgcatgccctgcgccgacgcatcgtcggcctcaattgcgggcgctgggat
tacatcttctcgtatctgaaaaccctgcgcgcccacccggaccgactgctgccggagcgg
agccaggtcggcatgggcgtgccgttcctgaaggcctattccgaactgctgatcaagacc
tgccaccagcgcggcgcgctggccatgggaggaatggccgcccagattccgatcaagggt
gatgagcaggccaaccaggcggcgctggacaaggtacgcgccgacaagttgcgcgaagtg
caggccggtcacgacggcacctgggtcgcccatccggcactggtcccgattgctgccgaa
atattcgacacctatatgccaggccccaatcagctgggccagctacggctggatgtgcag
gtcagcgccgagcagctgctggccgtcccggcaggtgacatcagccgggatggcttcgag
aacagcatcgaggtctgtctgcgctataccgccgcctggctggccggtcagggctgcgtg
cccatccaccacctgatggaagacgccgccaccgccgaaatttcgcgcgcccagctgtgg
caatggttgcactacccggtcacctcgggtcagccaccactgcagctgagcgacggcagc
aacatcgacttcagcttgttcgaccaggtgctggaagccaatcggcaggcactggccacc
agccaatggccgggtgccgccaaggccgatgccgccgccgaactgctggccacgctgagc
catgccccccaattgaccgacttcctcaccctgccggcctatcgccagctgtga

DBGET integrated database retrieval system