KEGG   Frateuria aurantia: Fraau_0491Help
Entry
Fraau_0491        CDS       T01773                                 

Definition
(GenBank) protein-L-isoaspartate carboxylmethyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fau  Frateuria aurantia
Brite
Enzymes [BR:fau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fraau_0491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 Methyltransf_2 MTS Ubie_methyltran Methyltransf_4 RrnaAD Methyltransf_23 PrmA Methyltransf_18 Methyltransf_24 Methyltransf_3 GCD14 Methyltransf_32 Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFC84978
UniProt: H8L4E5
Position
complement(548320..548985)
Genome map
AA seq 221 aa AA seqDB search
MAMNLELARQNMIEQQVRPWAVLDADVLNVLARVPREDFVPAAYRQLAFADLALPIGHGQ
VMLKPVIEGRLLQALALQPHESVLEIGTGSGFLTACLAALVPAGKVLSLDIEPDFIAQAA
PKLLSAGFRHVELLAADAFGDSLPQQSFDAIVLSGASARIPQDFLHWLKPGGRLFVIHGQ
SPAQKAVLLTRGQGSEIREDELFETDVPYLTHAEPSRQFVF
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggctatgaatctcgaactggcgcgccagaacatgatcgaacagcaggtgcggccctgg
gccgtcctcgatgcggacgtgctgaatgtactggcgcgagtgcctcgcgaagactttgtg
cccgcggcctatcgtcagctcgccttcgcggatctggccctgcccatcggacacggccag
gtgatgctgaagcccgtgatcgaaggccggctgcttcaggcgcttgcgctgcagccgcac
gaatcggtgctggagatcggcaccggttcgggctttctcaccgcctgtctggctgcactg
gtgcctgccggcaaggtgctgagtctggacatcgaacctgacttcattgcccaggccgcg
ccgaaactgctttccgccggcttccgccatgtggagttgctggccgccgatgcttttggc
gacagcctgccgcaacagagcttcgatgccatcgtcctcagcggggcctcggcccggatt
ccacaggatttcctgcactggctgaagcccggcggtcggctgttcgtgatccatggtcag
tcgccggcgcagaaggccgtgctgctgacccgcggccagggcagcgagatccgagaggac
gagctgtttgaaaccgatgtcccctacctgacccacgccgaaccgtcgcgccagttcgtg
ttctga

DBGET integrated database retrieval system