KEGG   Frateuria aurantia: Fraau_0558Help
Entry
Fraau_0558        CDS       T01773                                 

Definition
(GenBank) ABC-type sugar transport system, periplasmic component
  KO
K10227  
sorbitol/mannitol transport system substrate-binding protein
Organism
fau  Frateuria aurantia
Pathway
ABC transporters
Module
Putative sorbitol/mannitol transport system
Brite
KEGG Orthology (KO) [BR:fau00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Fraau_0558
Transporters [BR:fau02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative sorbitol/mannitol transporter [MD:M00200] [OT]
    Fraau_0558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
627508..628872
Genome map
AA seq 454 aa AA seqDB search
MRGTKRQRILVRGMALLTGLVAVPAAAADRVTLTVGTVNNADMVRMQALTPDYEASHPGV
RLHWVVLEENTLRQRLTTDIATGSGQFDVMTIGAYETPLWGQRHWLSPLDKLPAGYGLDD
LFPNVRAQLTADGHLYALPFYAEASITYYRKDLFRARGLQMPAAPSWQQIRDFADQLNDP
AHGVYGICLRGKAGWGENMAIIGSMVNAFGGRYFDMQWQPQFDTPPWHQAVRFYRDLLRK
DGPPGVSANGFNESLALFAAGKCAQWVDASVAGGVLTDPKQSQVAASVGFARAPHAVTDR
GSSWQYIWSLAVPVSSRQQAAATEFIAWATSREYRDLVASRYGLAASPPGTRLSTYRNPA
YMQQVPFAKVTLDSLLAVDPVKPTLLPVPYKGIQFATIPEFQAIGSLVGREISGVLAGRG
QVDEVLHVSQQAVRRTMRRAGYDRAAVQPASGAP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgagaggaacaaagcggcagcggatactggtccgggggatggcgctcctgacggggctg
gtcgcggttccggccgccgccgccgatcgggtcactctgaccgtcggcacggtcaacaat
gccgacatggtgcggatgcaggcgctgaccccggactacgaggccagtcaccccggcgtc
aggctgcactgggtggtgctggaagaaaacaccctgcgccagcggctgaccaccgacatc
gccaccggcagcggccagttcgacgtgatgaccatcggcgcctacgagacgcccttgtgg
gggcaacgccactggttgtcgccactcgacaagctgccggccggatacggcctcgacgac
ctgtttcccaatgtacgggcccagctgaccgcagacggccatctctatgcgctgcccttc
tatgccgaggcctcgatcacctattaccgcaaggacttgttcagggcccgcgggctgcag
atgccggccgcgcccagctggcagcagatccgcgattttgccgatcagctgaatgacccg
gcgcatggtgtctacggcatctgtctgcggggcaaggccggctggggcgagaacatggcc
atcatcggcagcatggtgaatgccttcggcggacgctatttcgatatgcaatggcagccg
cagttcgatacgccgccctggcaccaggctgtccgcttctatcgggatctgctgcgcaag
gacggaccgcccggagtcagtgccaatggtttcaatgaaagcctggccttgttcgcggcc
ggcaaatgcgcgcaatgggtggatgccagcgtggccggcggcgtgctgaccgatccgaag
cagagccaggtcgccgcgagtgtcggtttcgcgcgggcgccgcatgctgtcaccgatcgc
ggcagttcctggcaatacatctggtcactggcggtgccggtcagctcccgccagcaggcg
gcggccaccgagttcattgcctgggccacctcccgtgaatatcgcgatctggtggccagc
cgttatggcctggccgcctccccgccggggacacggctgtcgacctaccggaatccggcc
tatatgcagcaggtcccctttgccaaggtcaccctggattcgctgctggcggtggatccg
gtcaagccgaccctgctgccggtgccttacaagggcatccagttcgcgaccatccccgaa
ttccaggcgatcggcagtctggtcggtcgcgagatttcgggcgtgctggccggccgcggc
caggtcgacgaggtcctgcatgtttcgcaacaggccgtgcgcaggaccatgcgccgggcc
ggctatgaccgggcggccgtccaaccagccagcggagctccgtga

DBGET integrated database retrieval system