KEGG   Frateuria aurantia: Fraau_0599Help
Entry
Fraau_0599        CDS       T01773                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fau  Frateuria aurantia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:fau00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676727..678124
Genome map
AA seq 465 aa AA seqDB search
MVFRIERARVAQVRALCAIEREAVALFRQHPVWPSYAAMSIPEQLLREGIEAGLVWVAVD
EATARPLGFVWLERLNDDQVGICDFNVLPEQGRQGIGAALLKHACDWARAAGYRAVLLGT
VADVPWNAPFYAKHGFVQVDKQDPEFAFALQRDRDNGFPDPLRVFMRRDLSAVAADEWSV
WPAPAKLNLFLRIVGRRPDGYHELQTVFRILDWGDEISLRVRADGEIVRASELAEVPAEQ
DLVVRAARLLKNHTGCALGADIAVEKRVPMGGGLGGGSSDAATVLVALNELWQTGVDEDA
LAELGRQLGADVPVFTRGRSAWAEGIGEILRPVSLPRRWYVVIDPQEKVPTAGLFSAPEL
TRDAPATTISNFTAGLARDNTFEPVVRARHPRVAAALDWLGNHATAQLSGTGGCLFAEFD
SIEQARRIARRCPEEFSACVAEGMQDSPLALAVERHRRGNRQDLS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttcggattgaacgggcccgggtggcccaggtcagagccctgtgcgcgatcgag
cgcgaagcggtcgcattgtttcgccagcatccggtgtggccgtcctacgcggcgatgtcg
attcccgagcagctgctgcgcgaaggtatcgaggccggcctggtctgggtcgccgtggat
gaggccactgcccgcccgctgggctttgtctggctggagcgcctgaacgatgatcaggtc
gggatctgcgacttcaatgtcctgccggaacagggtcgccagggcattggcgcggccttg
ctcaagcatgcctgcgactgggcccgtgccgccggctaccgcgcggtgctgctgggcacc
gtcgccgatgtgccctggaatgcccctttctatgcgaaacacggctttgtgcaggtcgac
aagcaggatcccgaattcgcctttgccttgcagcgtgaccgcgacaacggctttccggac
cccttgcgggtctttatgcgccgggacctgagtgctgtggcggcggatgaatggtcggtc
tggccggcaccggccaagctgaacctgtttttgcgcatcgtaggccgtcggccggatggt
tatcacgagctgcagaccgtgttccggatcctggactggggcgacgagatcagcctgcgg
gtacgtgccgacggcgagatcgtccgcgccagcgagctggcggaggtaccggccgaacag
gatctggtagtgcgtgccgcccgattgctgaaaaaccacactggctgcgccttgggtgcc
gatatcgcggtggaaaagcgggtgccgatggggggcgggctgggcggcggcagttccgat
gccgccaccgtgctggtggccttgaacgagttgtggcagaccggcgtcgacgaagatgcg
ctggccgaactggggcgtcaattgggcgcagatgtaccggttttcacccgcggccgctct
gcctgggccgagggcattggcgaaattctgcgcccggtcagccttccccggcgctggtat
gtggtgatcgacccacaggaaaaggtgccgaccgcgggacttttcagcgcgccggaattg
acacgcgacgcgcctgccaccacaatctcgaacttcaccgcaggcttggcaagggacaac
accttcgagcccgtggtcagggcacgacaccctcgggtggccgccgcgctggactggctg
ggcaaccacgccaccgcgcagttgtcaggaaccggtggctgtctgtttgccgagttcgat
tccatcgagcaggcacggcgcatcgcaagacgctgccctgaagagttttccgcttgcgtg
gcggaaggcatgcaggattcgccgctggcactggccgtcgaacgccatcgccgcggcaac
cgccaggacctgtcctga

DBGET integrated database retrieval system