KEGG   Frateuria aurantia: Fraau_0599Help
Entry
Fraau_0599        CDS       T01773                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
fau  Frateuria aurantia
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fraau_0599
Enzymes [BR:fau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Fraau_0599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
676727..678124
Genome map
AA seq 465 aa AA seqDB search
MVFRIERARVAQVRALCAIEREAVALFRQHPVWPSYAAMSIPEQLLREGIEAGLVWVAVD
EATARPLGFVWLERLNDDQVGICDFNVLPEQGRQGIGAALLKHACDWARAAGYRAVLLGT
VADVPWNAPFYAKHGFVQVDKQDPEFAFALQRDRDNGFPDPLRVFMRRDLSAVAADEWSV
WPAPAKLNLFLRIVGRRPDGYHELQTVFRILDWGDEISLRVRADGEIVRASELAEVPAEQ
DLVVRAARLLKNHTGCALGADIAVEKRVPMGGGLGGGSSDAATVLVALNELWQTGVDEDA
LAELGRQLGADVPVFTRGRSAWAEGIGEILRPVSLPRRWYVVIDPQEKVPTAGLFSAPEL
TRDAPATTISNFTAGLARDNTFEPVVRARHPRVAAALDWLGNHATAQLSGTGGCLFAEFD
SIEQARRIARRCPEEFSACVAEGMQDSPLALAVERHRRGNRQDLS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttcggattgaacgggcccgggtggcccaggtcagagccctgtgcgcgatcgag
cgcgaagcggtcgcattgtttcgccagcatccggtgtggccgtcctacgcggcgatgtcg
attcccgagcagctgctgcgcgaaggtatcgaggccggcctggtctgggtcgccgtggat
gaggccactgcccgcccgctgggctttgtctggctggagcgcctgaacgatgatcaggtc
gggatctgcgacttcaatgtcctgccggaacagggtcgccagggcattggcgcggccttg
ctcaagcatgcctgcgactgggcccgtgccgccggctaccgcgcggtgctgctgggcacc
gtcgccgatgtgccctggaatgcccctttctatgcgaaacacggctttgtgcaggtcgac
aagcaggatcccgaattcgcctttgccttgcagcgtgaccgcgacaacggctttccggac
cccttgcgggtctttatgcgccgggacctgagtgctgtggcggcggatgaatggtcggtc
tggccggcaccggccaagctgaacctgtttttgcgcatcgtaggccgtcggccggatggt
tatcacgagctgcagaccgtgttccggatcctggactggggcgacgagatcagcctgcgg
gtacgtgccgacggcgagatcgtccgcgccagcgagctggcggaggtaccggccgaacag
gatctggtagtgcgtgccgcccgattgctgaaaaaccacactggctgcgccttgggtgcc
gatatcgcggtggaaaagcgggtgccgatggggggcgggctgggcggcggcagttccgat
gccgccaccgtgctggtggccttgaacgagttgtggcagaccggcgtcgacgaagatgcg
ctggccgaactggggcgtcaattgggcgcagatgtaccggttttcacccgcggccgctct
gcctgggccgagggcattggcgaaattctgcgcccggtcagccttccccggcgctggtat
gtggtgatcgacccacaggaaaaggtgccgaccgcgggacttttcagcgcgccggaattg
acacgcgacgcgcctgccaccacaatctcgaacttcaccgcaggcttggcaagggacaac
accttcgagcccgtggtcagggcacgacaccctcgggtggccgccgcgctggactggctg
ggcaaccacgccaccgcgcagttgtcaggaaccggtggctgtctgtttgccgagttcgat
tccatcgagcaggcacggcgcatcgcaagacgctgccctgaagagttttccgcttgcgtg
gcggaaggcatgcaggattcgccgctggcactggccgtcgaacgccatcgccgcggcaac
cgccaggacctgtcctga

DBGET integrated database retrieval system