KEGG   Frateuria aurantia: Fraau_0918Help
Entry
Fraau_0918        CDS       T01773                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fau  Frateuria aurantia
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fraau_0918
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fraau_0918
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fraau_0918
Enzymes [BR:fau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fraau_0918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1020017..1020820
Genome map
AA seq 267 aa AA seqDB search
MTRIERRFSELKAAGRTGLIPFVTAGDPLPEAMVPLMHALVAAGADLIELGLPFSDPMAD
GPVIQHASERAIARGTGLAQVLAWVAEFRRDDPVTPVVLMGYLNPIEIHGYARFAEEACA
AGIDGVLLVDCPLEESAVLEPLRQAGLDQILLAAPTTAPDRLAQLCEAARGFLYYVSFAG
ITGAARLSTADIADRVTGIRSRSQVPVAVGFGIRDADSARAVAAFADAVVIGSALVETLA
EAGGKDDLIERAGRFLAPIRQALDNDS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacacgtatcgaacgccgtttttccgaactcaaggcggctggccgcaccggcctgatt
ccctttgtcaccgccggcgatccgctgcccgaggcgatggtgccgctgatgcacgcactg
gtggccgcaggtgccgacctgatcgagctggggctgccgttttccgacccgatggccgat
ggcccggtgatccagcacgccagcgaacgtgccatcgcccgcggcaccggtctggcccag
gtgcttgcctgggtcgccgaattccgccgcgatgatccggtcacgccggtggtgctgatg
ggctacctcaacccgatcgagatccacggttacgcccgttttgccgaggaagcctgcgcg
gcaggcattgacggcgtgctgctggtggactgcccgctggaagaatcggcggtgctggaa
cccctgcgccaagccggcctggaccagatcctgctggcagcaccgaccacggccccggac
cgactggcgcagctgtgcgaagccgctcgcggtttcctgtactatgtctcattcgccggc
atcactggcgcggcgcggctgagtaccgccgacatcgctgatcgcgtgactggcatccgg
agccggtcgcaggttccggtggcggtgggtttcggcatccgcgacgccgacagtgcccgt
gccgtggcggcttttgccgatgcggtcgtgatcggttcggccctggtggagaccttggcc
gaggccggcgggaaagatgatctgatcgagcgggccggacgttttctggcccctatccgg
caggcgctggacaacgacagttga

DBGET integrated database retrieval system