KEGG   Frateuria aurantia: Fraau_0988Help
Entry
Fraau_0988        CDS       T01773                                 

Definition
phage-related lysozyme (muraminidase)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
fau  Frateuria aurantia
Brite
Enzymes [BR:fau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Fraau_0988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1073205..1073681
Genome map
AA seq 158 aa AA seqDB search
MAISRKPAAVAGLFGLAVAIAGWIIAPSEGNSPVGYADLAGVPTACLGHTGSGVVVGQRY
SEAQCQAWFASDVGAAARGVQACIHGPMTSYQWGAFTSTAFNIGVGQFCRSSIAAKANAG
DMPGACAAISLYVYAAGQPQPGLIRRRAAERALCEGHT
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctcccgtaagcccgcggccgtcgccggcctgttcggtttggctgtggccatc
gcaggctggatcatcgcgccatcggaaggcaacagccctgtgggctacgccgatctcgct
ggtgtgccgacggcatgccttggccacaccggctcgggcgtggttgtcggccagcgatac
agcgaggcgcagtgccaagcctggttcgccagtgatgtcggcgcggccgctcgtggcgtg
caggcctgcatccatggaccgatgaccagctaccaatggggcgcgttcacttcaacggcc
ttcaatatcggcgtcggacagttctgccggtcatcgatcgctgccaaggccaatgccggc
gacatgccgggcgcgtgcgccgcgatctcgctgtacgtgtatgccgcgggccagccgcaa
cccggattgatacggcgtcgcgcggccgagcgtgcgctgtgcgagggccatacctga

DBGET integrated database retrieval system