KEGG   Frateuria aurantia: Fraau_1140Help
Entry
Fraau_1140        CDS       T01773                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fau  Frateuria aurantia
Pathway
fau00010  Glycolysis / Gluconeogenesis
fau00020  Citrate cycle (TCA cycle)
fau00620  Pyruvate metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
Module
fau_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1140
   00020 Citrate cycle (TCA cycle)
    Fraau_1140
   00620 Pyruvate metabolism
    Fraau_1140
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Fraau_1140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding SspP
Motif
Other DBs
NCBI-ProteinID: AFC85599
UniProt: H8L405
Position
complement(1231475..1232791)
Genome map
AA seq 438 aa AA seqDB search
MAETKTFHLPDLGEGLPDATIIEWHVALGDAIKLDAPLLTVETAKAMVDVPSPYTGILTR
RHGEAGSVVVTGHPLAEFELDPNARQRAEAQPTGHHHAPATEAPRADQGSVVGAMVAGDQ
VHVEQTLSRDGVKAVPAVRALAHKLRVDLQQVMPSGADGVITMDDVKLAAAIGCARLPSE
APRPQGRPATEIAPPVAAPSVEIPPQRAPLSQAGKPIRTAPPSQPTPGQPEPLRGVHRNM
ARVMADAHAQVVLTTLVDDADLHAWIGKQDITARLVRAVVAACRIAPALNAWFDGKELTR
TLHPHVDLGIAMDSADGLFVPTLRNADMLDAASIREGINRLRSQVEDRSIAPSELTGSTI
SLSNFGTIAGRYGTPIVVPPAVAIIGAGRLSHDVVAVMGGIEVHRRLPLSLSFDHRAVTG
GDAARFLKAMLDDLALPH
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaccaagaccttccacctgccggatctgggcgagggcctccctgatgccacc
atcatcgaatggcatgtcgccctcggtgacgccatcaagcttgacgcgccgctgctgacg
gtggaaaccgccaaggccatggtcgatgtgccctcgccttataccggcatcctgacccgc
cgccatggcgaggccggctcggtggtggtcaccggccatccgctggccgagttcgaactg
gacccgaacgccaggcagcgtgccgaagcgcagcccaccggccatcaccatgccccggct
accgaggcgccgcgtgccgatcagggttcggtggtcggtgccatggttgccggcgatcag
gtgcatgtggaacagaccctcagccgggacggcgtcaaggccgtgccggcggtacgggct
ctggcccacaagctgcgggttgacctgcagcaggtgatgcccagtggcgccgatggcgtg
atcaccatggacgatgtcaagctggccgccgcgatcggctgcgcccggctgcccagcgaa
gccccgcgcccgcagggtcggcccgccaccgagatcgcccctcctgttgccgcgcccagc
gtcgagatcccgccccagcgtgcgccattgagccaggccggcaagccgatccgcaccgca
ccgcccagccagccgaccccgggtcagcccgaaccgctgcggggcgtgcatcgcaatatg
gccagggtcatggccgatgcccacgcccaggtggtactgaccaccctggtcgatgatgcc
gacctgcatgcctggatcggcaagcaggacatcacggcccgcctggtccgggccgtggtc
gccgcctgccgcatcgctcccgcgctgaacgcctggttcgacggcaaggaactgacccgg
accctgcatccgcatgtggatctgggcattgcgatggacagcgccgacggcttgttcgtg
ccgaccctgcgcaatgccgacatgctggatgccgccagcatccgcgaaggcatcaaccgt
ctgcgcagccaggtcgaggaccgcagcatcgccccctccgaactgaccggcagcaccatc
agcctgtccaacttcggcaccatcgccggccgttacggcacgccgatcgtggtcccgccg
gccgtggccatcatcggcgccggccgcctgagccacgacgtggtggccgtgatgggcggc
atcgaagtccatcgccggctgccgctgtcgctgagcttcgaccaccgcgccgtcaccggc
ggcgatgccgcgcgcttcctgaaagccatgctggacgatctggccctgccgcactga

DBGET integrated database retrieval system