KEGG   Frateuria aurantia: Fraau_1274Help
Entry
Fraau_1274        CDS       T01773                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
fau  Frateuria aurantia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fraau_1274
Enzymes [BR:fau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Fraau_1274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1372003..1374009)
Genome map
AA seq 668 aa AA seqDB search
MNAVVMHGLEDRSATLELLAQWSTQDWLRPLDLALARFFADLDPQAPPLLLLAAALVSHQ
LGQGHVCLDFGSTLANPDFALSLPPEGQRPDPGTVMPSQLLAGIEATQWLAALTPSPLVG
HAAPGSSPLVLAGQALYLRRYWNYETGVARQIAARTSPALHAPPRLAERLETLFPEPTDT
TDWQKIACALAASGPFSLITGGPGTGKTTTVVKLLALLQQAAMDEGTPLRLSLAAPTGKA
AARLTESIGAQVSQLPVTEAVRERIPSEVTTVHRLLGRVPNSRRFRHHAGHKLSLDVLVV
DEASMIDLEMMFHLLAALPDTARLILLGDKDQLASVEAGAVLGDLCRDAELGHYSPSTAD
WLRRQGIGRLEDPALQPGDEHQRLAQHTVMLRRSRRFGHDSGIGRLARAVNAGDAVEADA
VLHERPHDVLHLSCKGPDDPALDRLLLDGQGGAAGYAAYLQRLHQRPADDAETGVWHAWA
ADILQAFERFRLLTAVRKGPWGVEQMNLRITQALQRQGLLSAGPTWFEGRPVMVTRNDYS
LGLMNGDVGITLRLPLSDTDGQRRHGLRVVFPRNDGSNALRWVLPSRLGAVETVFAMTVH
KSQGSEFAHTALLLPDRLSPVLTRELIYTGITRARTHFSLIETRSGLFPQAVQRRVVRRS
GLRALIGG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaatgccgtcgtgatgcacggtctggaggatcgctccgccaccctggagctgctcgcc
cagtggagcacacaggattggctgcgaccgctggacctggccctggcgcgtttttttgcc
gatctggacccgcaggcgccgcccttgcttctgctggccgctgccctagtcagccatcag
ctgggtcagggccacgtctgcctggacttcggcagtaccctggccaaccccgacttcgcg
ctgtcgctgccaccggaaggtcagcgccccgatcccggtaccgtgatgccgtcccagctg
ctggctgggatagaggccacgcaatggctggccgcactgactcccagtccgttggtcgga
cacgccgcgccaggctccagtccactggtgcttgccggtcaggccttgtatctgcgtcga
tactggaattacgaaaccggtgtcgcccgccagatcgccgcgcggacaagccccgccctg
catgcaccgccccgtcttgccgaacggctggagaccttgttcccggaacccaccgacacc
accgattggcaaaagattgcctgcgcactggccgcctccggccctttcagcctgatcacc
ggcggacccggcaccggcaagaccaccaccgtggtcaagctgctggccctgctgcaacag
gcagccatggatgagggcacgcccctgcggctgagcctcgccgcgcccaccggcaaggcg
gcggcacgcctgaccgagtcaatcggcgcccaggttagccagctgccggtgaccgaagcg
gtccgcgagcggattccctccgaggtgaccaccgtgcaccggctgctgggtcgggtaccc
aacagtcgacgcttccgccatcatgcgggtcacaagctgtctctggacgtgctggtggtc
gacgaagcctcgatgatcgacctggaaatgatgttccatctgctggctgcgctgcccgac
acggcacggctgatcctgctgggcgacaaggaccagcttgcctcggtggaagccggcgcg
gtactgggcgacctgtgccgggatgccgagctgggccattacagtccctccaccgccgac
tggctgcgccgccagggcatcggccgcctcgaagacccggccctgcagccaggtgacgaa
catcagcgactggcccagcatacggtgatgctgcgtcgctcccgccgtttcggccatgac
tcgggcatcggccgtctggcccgagcggtcaacgccggcgatgccgtcgaggccgatgcg
gttctgcacgagcggccccatgacgtgctgcacctgagctgcaagggaccagatgatccc
gcgctggatcggcttctgctcgacggccaaggcggcgctgcgggctatgcggcctatctg
caacgcctgcatcaacgcccggcagatgatgccgagaccggagtctggcacgcctgggcg
gcggacatcctgcaggccttcgagcgctttcgcctgctcaccgccgtccgcaagggcccc
tggggcgtggaacagatgaatctgcggatcacccaggccctgcagcgacagggactgctg
agcgccggaccgacctggttcgaaggccggccagtgatggtcacccgcaacgactacagc
ctgggactgatgaatggcgatgtcggcatcacgctgcgactgcccttgtccgacaccgat
gggcagcgccgtcacggtttgcgggtggtgtttccccgcaatgacggcagcaacgccttg
cgatgggtgctgcccagccgtctgggtgcggtcgagaccgtgttcgcgatgaccgtgcac
aaatcgcagggctccgaattcgcccacacggcgctgctcctgccggacagactcagcccg
gtgctcactcgcgagctgatctataccggcatcactcgcgcaagaacgcatttcagcctg
atcgagacgcgctcgggactgtttccccaggccgtgcaacgccgggtcgtgcgccgcagc
ggactgcgcgccctgatcggcggatag

DBGET integrated database retrieval system