KEGG   Frateuria aurantia: Fraau_1280Help
Entry
Fraau_1280        CDS       T01773                                 

Definition
Mg-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fau  Frateuria aurantia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fau00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1387391..1388449
Genome map
AA seq 352 aa AA seqDB search
MSAATDPAGSRPDYPFSALVGLEPLRRFLLLAAVDPGLGGVLISGPRGTAKSTSARALAA
LLPEGRLVNLPLGATEERLIGSLDLEAMLRDGELRFRPGLLAAAHQGVLYVDEVNLLPDA
LVDALLDVAASGVNSIEREGISHRHPARFVLIGTMNPEEGEVRPQLLDRFGLMVELDNCL
DPQQRQAMVRARLDYESDPQAFHARHREMDAALRQRLLAARAALAELDFDEAVHERVSRW
CIAAAVDGVRADLAMLRAARALAAWEGAQAVTIEHVDQVAAACLRHRCRQLPAAPSSADG
PAPQDHDARSGPDEASTTGRHPGDDEGDFGELPPEPVGMTPVKAVRPLLPKP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctgccacggatcccgccggaagccgcccggactatcccttttcggccctggtc
gggctggagccgctgcgccggttcctgcttctggccgcggtcgatccgggtctgggcggc
gtgctgatcagcggtccgcgcggcacggccaaatcgaccagtgcccgcgcgctggcggcg
ctgctgcctgaaggccggctggtgaatctgccgctgggcgcgaccgaagagcgtctgatc
ggcagcctggatctggaggcgatgctgcgtgacggcgagttgcgcttcaggcccggcctg
ctggcggcggcgcatcaaggcgtgctgtatgtcgacgaagtcaatctgctgccggatgcg
ctggtggatgccttgctggacgtggcggccagcggcgtcaacagcatcgagcgcgaaggc
atttcccaccgtcatcctgcccgtttcgtgctgatcggcaccatgaatccggaagagggc
gaagtgcgtccgcagttgctggaccgtttcggtctgatggtcgagctggacaattgcctg
gacccgcagcaaaggcaggccatggtgcgggcgcggctggactacgagtccgatccgcag
gcctttcatgcacgtcatcgggagatggacgcggctttgcgtcagcgcctgctcgccgca
cgggccgccctggccgagctggatttcgacgaggccgtgcatgagcgcgtcagccgctgg
tgcattgccgctgccgtcgacggcgtacgtgccgatctggccatgctgcgggccgcccgg
gcgctagcggcctgggagggcgcgcaggcggtgacgatcgagcatgtggatcaggtggca
gcggcctgtctgcggcatcgctgccggcagctgccagcggcgccgtcgtcagcggacggg
ccggcgccccaggatcatgatgcccggtccggtccggatgaggcttcgacaaccggccgg
catcccggtgacgacgaaggggacttcggcgagctgccgcccgagccggtcggcatgacg
ccggtcaaggccgtgcggccgctgctcccaaaaccctag

DBGET integrated database retrieval system