KEGG   Frateuria aurantia: Fraau_1372Help
Entry
Fraau_1372        CDS       T01773                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fau  Frateuria aurantia
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fau00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fau00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fau00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1482867..1484069)
Genome map
AA seq 400 aa AA seqDB search
MTRTHLRRCLGLLLGLTAFGSRAAEITASTPPMGWSSWNHFAEHVTAAEIRATADAMVSS
GMRDAGYVYVNIDDGWQGGRNPDGSIRPNAGFPDMRALADYVHARGLKLGIYSSPGRHTC
AGYTGSLGHEQQDAASYAAWGVDYLKYDLCSYIQDVMQPQAPHDMGRQMALMHQAYQRMR
VALDRQSRPIIYALCQYGWGAPWQWATRPDVDGQLWRTTSDIEPDWDRIYAIAESQDGLA
DYAGPGHWNDPDMLEVGNGHLSDAENRAHFSWWAMLAAPLIAGNDLRHMSLKVRDILTLS
AVIAIDQDPLGRPATRTYADGQVEVWSRPLADGDRAVAIFNIGSARYASAPWSLDLKRLD
LHGPQEATDLWSGRRYTLVQGMPLQLARHDVLLLRLHHPH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactcggacccacctgcgccgctgccttggcctgctgcttggcctcaccgccttcggc
agccgcgccgcggagatcaccgcgtccactccgccgatgggctggagcagctggaatcat
ttcgccgaacacgtcaccgccgctgaaataagggccactgccgacgcgatggtcagcagc
ggcatgcgtgatgcaggctatgtgtatgtcaatatcgacgatggctggcagggcggacgc
aatcccgacggcagcattcgtccgaatgccggttttcccgacatgcgcgccctggcggac
tatgtacatgcccgcggcctcaagctcggtatctactcctcgcccggccgccatacctgc
gcgggctacacaggatcgctgggtcatgagcaacaggatgccgccagctatgccgcctgg
ggcgtggactatctgaaatacgatctgtgcagctatatccaggacgtgatgcagccacag
gcaccgcatgacatgggccgtcagatggccctgatgcatcaggcctaccagcgcatgcgg
gtcgctcttgaccggcaatcacgccccatcatctacgccctgtgccaatacggctggggc
gcgccatggcaatgggcgacccggcccgatgtcgatggccagctgtggcgtaccaccagt
gacatcgagccggactgggaccggatctacgccattgccgaatcacaggacgggctggcg
gattacgccggacctggccactggaacgatccggacatgctggaggtcggcaatggccac
ctcagcgacgcggagaatcgggcccacttcagctggtgggcgatgctggcggcaccactt
atagctggcaacgatctgcgtcatatgtcgctcaaggtcagggacatcctgaccttgagc
gccgtcatcgccatcgaccaggatccgctcggccgccccgccacccgcacctatgccgat
gggcaagtcgaagtctggtcccgaccgctggcggacggtgatcgtgccgtggccattttc
aatatcggcagcgcccgctacgcctccgccccctggtcgctggatctgaagcgactggat
ctgcacggtccgcaggaggccaccgacctatggagcgggcgccgctacaccctggtccag
ggcatgcccttgcagctggcacgccatgacgtgctgctgctgcgcctccatcatccgcac
tga

DBGET integrated database retrieval system