KEGG   Frateuria aurantia: Fraau_1372Help
Entry
Fraau_1372        CDS       T01773                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fau  Frateuria aurantia
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fraau_1372
  Lipid metabolism
   00561 Glycerolipid metabolism
    Fraau_1372
   00600 Sphingolipid metabolism
    Fraau_1372
Enzymes [BR:fau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Fraau_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1482867..1484069)
Genome map
AA seq 400 aa AA seqDB search
MTRTHLRRCLGLLLGLTAFGSRAAEITASTPPMGWSSWNHFAEHVTAAEIRATADAMVSS
GMRDAGYVYVNIDDGWQGGRNPDGSIRPNAGFPDMRALADYVHARGLKLGIYSSPGRHTC
AGYTGSLGHEQQDAASYAAWGVDYLKYDLCSYIQDVMQPQAPHDMGRQMALMHQAYQRMR
VALDRQSRPIIYALCQYGWGAPWQWATRPDVDGQLWRTTSDIEPDWDRIYAIAESQDGLA
DYAGPGHWNDPDMLEVGNGHLSDAENRAHFSWWAMLAAPLIAGNDLRHMSLKVRDILTLS
AVIAIDQDPLGRPATRTYADGQVEVWSRPLADGDRAVAIFNIGSARYASAPWSLDLKRLD
LHGPQEATDLWSGRRYTLVQGMPLQLARHDVLLLRLHHPH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgactcggacccacctgcgccgctgccttggcctgctgcttggcctcaccgccttcggc
agccgcgccgcggagatcaccgcgtccactccgccgatgggctggagcagctggaatcat
ttcgccgaacacgtcaccgccgctgaaataagggccactgccgacgcgatggtcagcagc
ggcatgcgtgatgcaggctatgtgtatgtcaatatcgacgatggctggcagggcggacgc
aatcccgacggcagcattcgtccgaatgccggttttcccgacatgcgcgccctggcggac
tatgtacatgcccgcggcctcaagctcggtatctactcctcgcccggccgccatacctgc
gcgggctacacaggatcgctgggtcatgagcaacaggatgccgccagctatgccgcctgg
ggcgtggactatctgaaatacgatctgtgcagctatatccaggacgtgatgcagccacag
gcaccgcatgacatgggccgtcagatggccctgatgcatcaggcctaccagcgcatgcgg
gtcgctcttgaccggcaatcacgccccatcatctacgccctgtgccaatacggctggggc
gcgccatggcaatgggcgacccggcccgatgtcgatggccagctgtggcgtaccaccagt
gacatcgagccggactgggaccggatctacgccattgccgaatcacaggacgggctggcg
gattacgccggacctggccactggaacgatccggacatgctggaggtcggcaatggccac
ctcagcgacgcggagaatcgggcccacttcagctggtgggcgatgctggcggcaccactt
atagctggcaacgatctgcgtcatatgtcgctcaaggtcagggacatcctgaccttgagc
gccgtcatcgccatcgaccaggatccgctcggccgccccgccacccgcacctatgccgat
gggcaagtcgaagtctggtcccgaccgctggcggacggtgatcgtgccgtggccattttc
aatatcggcagcgcccgctacgcctccgccccctggtcgctggatctgaagcgactggat
ctgcacggtccgcaggaggccaccgacctatggagcgggcgccgctacaccctggtccag
ggcatgcccttgcagctggcacgccatgacgtgctgctgctgcgcctccatcatccgcac
tga

DBGET integrated database retrieval system