KEGG   Frateuria aurantia: Fraau_1385Help
Entry
Fraau_1385        CDS       T01773                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fau  Frateuria aurantia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fraau_1385
DNA repair and recombination proteins [BR:fau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fraau_1385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1496800..1497399
Genome map
AA seq 199 aa AA seqDB search
MNGSPLLAELVDALRCLPGVGQKSAQRMAYQLLQRERGRGLKLASVMTEALQRIGHCSQC
RTFSETPVCGICGNPGRDRHLLCVVESPVELAAIEQATGYRGCYFVLLGRLSPLDGMGPA
ELGLDRLTQRLAEGEVEELIIATNPTVEGEATAHYLAQLARAGGIRASRLAHGVPLGGEL
EFVDRGTLAHAFGGRQSAD
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaacggctcgcccttgctggccgagctggtggatgccttgcgctgcctgccgggtgtc
gggcagaaaagtgcccagcggatggcttatcagctattgcagcgggagcgcgggcgcggc
ttgaaactggcctcggtcatgaccgaagccttgcagcggatcggccattgcagtcaatgc
cgcaccttcagtgaaaccccggtctgcggcatctgtggcaatccagggcgcgaccggcat
ctgctgtgcgtggtggagtcaccggtggagctggcggcgatcgagcaggcgacgggttac
cgtggttgctatttcgtgctgctcgggcgcttgtcgcctctggatggcatggggccggcc
gagctggggctggatcgcctgactcagcgtttggccgagggcgaggtcgaggagctgatc
attgctaccaatcccacggtcgagggtgaggccacggcgcattatctggcccagctggca
cgggccggcggtattcgcgccagtcggctggctcatggtgttcccttgggaggggagctg
gagtttgtggaccgcgggaccttggctcatgcttttggcggacgtcaatcggcggattag

DBGET integrated database retrieval system