KEGG   Frateuria aurantia: Fraau_1543Help
Entry
Fraau_1543        CDS       T01773                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fau  Frateuria aurantia
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fraau_1543
   00670 One carbon pool by folate
    Fraau_1543
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Fraau_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1634460..1634981
Genome map
AA seq 173 aa AA seqDB search
MAGSITLSMVVAMDQAHAIGIEGHMPWHLPDDLRWFKQVTLGKPVLMGHATAISIGRSLP
GRLNLVLSRRNGAAPFDGQQRVSSLEEALEVCRDAGAAELMVIGGGQVYAQCIERADRLY
ISHIKTKVDEADTWFPEFEWHQWREVSRQPHPADAQHVFAFDMITLERVQASV
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcagcattactctgagcatggtggtggccatggatcaagcccatgccattggc
atcgaaggacatatgccatggcatcttccggacgatctgcgctggttcaagcaggtgacg
cttggcaagccggtgctgatggggcatgccaccgcgatttccattggacgcagcttgccg
ggcagattgaatctcgtgctgtcacggcggaatggggcggcaccgtttgatggccagcag
cgggtgtcttcactcgaggaagcgcttgaggtctgtcgggatgcgggagcggccgagttg
atggtgatcggtggtggccaggtctatgcgcaatgcatcgagcgggcggatcgcctgtat
ataagccacatcaagacgaaggttgacgaggctgatacatggtttcccgagtttgaatgg
catcagtggcgcgaagtatcccgtcaaccgcacccggccgatgcacagcatgtcttcgcc
ttcgacatgatcacgctggagcgggtgcaggcctcggtctga

DBGET integrated database retrieval system