KEGG   Frateuria aurantia: Fraau_1625Help
Entry
Fraau_1625        CDS       T01773                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Fraau_1625
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1625
  Lipid metabolism
   00071 Fatty acid degradation
    Fraau_1625
  Amino acid metabolism
   00350 Tyrosine metabolism
    Fraau_1625
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fraau_1625
   00626 Naphthalene degradation
    Fraau_1625
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Fraau_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1721346..1722371
Genome map
AA seq 341 aa AA seqDB search
MSKTMQAAVVRQFGGPLSIEEVTVPSPGLGEVLVKIEACGVCHTDLHAVDGDWPVKPTLP
FIPGHEGVGHVVAIGPGVSHLKEGDRVGIPWLYSACGHCEHCLGGWETLCETQQNSGYSV
NGGFAEYALAAADYVGRLPDKVGFIEIAPVLCAGVTVYKGLKVTETRPGQWVVISGIGGL
GHMAVEYAKAMGLNVVAVDIDDGKLALARRLGADFTINAKAVDPVAAIKKEIGGAHGALV
TAVSPSAFGQAMNMVRRGGTVALNGLPPGNFDLSIFDMVLNGITVRGSIVGTRLDLQESL
DFAAEGKVKATVVTDKLENINQVFERMHKGQIEGRVVLDFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccatgcaagcggcggtagtgcgccagttcggcggcccgttgagcatcgag
gaagtgacggtgcccagccccgggctgggcgaggtgctggtgaagatcgaagcctgcggt
gtctgtcacaccgatctgcacgccgtggatggcgattggccggtcaagccgacgctgcct
ttcattcccggccatgagggggtcggccatgtggtcgccatcggtcctggagtaagtcat
ctcaaggaaggtgatcgggtcgggattccctggctctactcggcctgcggccattgcgag
cactgtctgggtggctgggagaccttgtgcgagacccagcagaattcgggctattcggtg
aatggcggctttgccgagtatgcgctggcggcggccgattatgtgggccggctgccggac
aaggtcggtttcatcgagatcgcgccggtgctctgcgccggggtgaccgtctacaagggc
ctgaaggttaccgagacccgtccgggtcagtgggtggtgatctccggcattggcgggctg
ggtcatatggcggtggaatatgccaaggccatgggcttgaacgtggtggccgtggatatt
gatgatggcaagctggcgctggccagacgtctcggcgccgatttcactatcaatgccaag
gccgtcgacccggtcgccgcgatcaagaaggagatcggcggcgctcatggcgcactggtc
acggcggtgtcgccctcggcctttggtcaggccatgaacatggtccgccgtggcggtacc
gtggcgctcaacggcctgccgcccggcaatttcgacttgtcgatcttcgatatggtgctg
aacggcatcaccgtccgtggctcgatcgtaggtacccggttggacctgcaggagtcactg
gactttgccgccgagggcaaggtcaaggccaccgtggtgaccgacaagctggaaaacatc
aaccaggttttcgagcggatgcacaagggccagatcgagggtcgggtggtactcgacttc
cattga

DBGET integrated database retrieval system