KEGG   Frateuria aurantia: Fraau_1625Help
Entry
Fraau_1625        CDS       T01773                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fau  Frateuria aurantia
Pathway
fau00010  Glycolysis / Gluconeogenesis
fau00071  Fatty acid degradation
fau00350  Tyrosine metabolism
fau00625  Chloroalkane and chloroalkene degradation
fau00626  Naphthalene degradation
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1625
  Lipid metabolism
   00071 Fatty acid degradation
    Fraau_1625
  Amino acid metabolism
   00350 Tyrosine metabolism
    Fraau_1625
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fraau_1625
   00626 Naphthalene degradation
    Fraau_1625
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Fraau_1625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C TrkA_N 2-Hacid_dh_C ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: AFC86040
UniProt: H8L6V4
Position
1721346..1722371
Genome map
AA seq 341 aa AA seqDB search
MSKTMQAAVVRQFGGPLSIEEVTVPSPGLGEVLVKIEACGVCHTDLHAVDGDWPVKPTLP
FIPGHEGVGHVVAIGPGVSHLKEGDRVGIPWLYSACGHCEHCLGGWETLCETQQNSGYSV
NGGFAEYALAAADYVGRLPDKVGFIEIAPVLCAGVTVYKGLKVTETRPGQWVVISGIGGL
GHMAVEYAKAMGLNVVAVDIDDGKLALARRLGADFTINAKAVDPVAAIKKEIGGAHGALV
TAVSPSAFGQAMNMVRRGGTVALNGLPPGNFDLSIFDMVLNGITVRGSIVGTRLDLQESL
DFAAEGKVKATVVTDKLENINQVFERMHKGQIEGRVVLDFH
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaccatgcaagcggcggtagtgcgccagttcggcggcccgttgagcatcgag
gaagtgacggtgcccagccccgggctgggcgaggtgctggtgaagatcgaagcctgcggt
gtctgtcacaccgatctgcacgccgtggatggcgattggccggtcaagccgacgctgcct
ttcattcccggccatgagggggtcggccatgtggtcgccatcggtcctggagtaagtcat
ctcaaggaaggtgatcgggtcgggattccctggctctactcggcctgcggccattgcgag
cactgtctgggtggctgggagaccttgtgcgagacccagcagaattcgggctattcggtg
aatggcggctttgccgagtatgcgctggcggcggccgattatgtgggccggctgccggac
aaggtcggtttcatcgagatcgcgccggtgctctgcgccggggtgaccgtctacaagggc
ctgaaggttaccgagacccgtccgggtcagtgggtggtgatctccggcattggcgggctg
ggtcatatggcggtggaatatgccaaggccatgggcttgaacgtggtggccgtggatatt
gatgatggcaagctggcgctggccagacgtctcggcgccgatttcactatcaatgccaag
gccgtcgacccggtcgccgcgatcaagaaggagatcggcggcgctcatggcgcactggtc
acggcggtgtcgccctcggcctttggtcaggccatgaacatggtccgccgtggcggtacc
gtggcgctcaacggcctgccgcccggcaatttcgacttgtcgatcttcgatatggtgctg
aacggcatcaccgtccgtggctcgatcgtaggtacccggttggacctgcaggagtcactg
gactttgccgccgagggcaaggtcaaggccaccgtggtgaccgacaagctggaaaacatc
aaccaggttttcgagcggatgcacaagggccagatcgagggtcgggtggtactcgacttc
cattga

DBGET integrated database retrieval system