KEGG   Frateuria aurantia: Fraau_1644Help
Entry
Fraau_1644        CDS       T01773                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
fau  Frateuria aurantia
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_1644
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fraau_1644
   00650 Butanoate metabolism
    Fraau_1644
  Energy metabolism
   00190 Oxidative phosphorylation
    Fraau_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1741658..1742044
Genome map
AA seq 128 aa AA seqDB search
MKPSMRNPLKRARGMGSSQFGVGHWWQQRVTAVALVVLVLWLVYTLLGLVHADYATAHAV
MARPFNAVLLIAFSMAVFWHAALGLQVVIEDYVHTRWKEVLLLVLIKFAAVLGVLASVLA
VLRIALAS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaagccttcgatgcgcaatcccttgaagcgtgcgcgcggcatgggttcctcgcagttc
ggcgtcgggcattggtggcaacagcgcgtgacggctgtcgccttggtggtgctggtgttg
tggctggtctacaccctgctggggctggtccatgctgattacgcaaccgctcacgcggtg
atggcgcggccattcaatgcggtgctgctgatcgccttctccatggccgtgttctggcat
gccgcactcggcttgcaggtggtgatcgaagactacgtgcacacccgttggaaggaggtc
cttctgctggtgttgatcaagtttgcagcggtgctcggtgttctggcgagcgtattggca
gtcctgcgcatcgcgctggcctcctga

DBGET integrated database retrieval system