KEGG   Frateuria aurantia: Fraau_1644Help
Entry
Fraau_1644        CDS       T01773                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
fau  Frateuria aurantia
Pathway
fau00020  Citrate cycle (TCA cycle)
fau00190  Oxidative phosphorylation
fau00650  Butanoate metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
Module
fau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fraau_1644
   00650 Butanoate metabolism
    Fraau_1644
  Energy metabolism
   00190 Oxidative phosphorylation
    Fraau_1644
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AFC86058
UniProt: H8KY64
Position
1741658..1742044
Genome map
AA seq 128 aa AA seqDB search
MKPSMRNPLKRARGMGSSQFGVGHWWQQRVTAVALVVLVLWLVYTLLGLVHADYATAHAV
MARPFNAVLLIAFSMAVFWHAALGLQVVIEDYVHTRWKEVLLLVLIKFAAVLGVLASVLA
VLRIALAS
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaagccttcgatgcgcaatcccttgaagcgtgcgcgcggcatgggttcctcgcagttc
ggcgtcgggcattggtggcaacagcgcgtgacggctgtcgccttggtggtgctggtgttg
tggctggtctacaccctgctggggctggtccatgctgattacgcaaccgctcacgcggtg
atggcgcggccattcaatgcggtgctgctgatcgccttctccatggccgtgttctggcat
gccgcactcggcttgcaggtggtgatcgaagactacgtgcacacccgttggaaggaggtc
cttctgctggtgttgatcaagtttgcagcggtgctcggtgttctggcgagcgtattggca
gtcctgcgcatcgcgctggcctcctga

DBGET integrated database retrieval system