KEGG   Frateuria aurantia: Fraau_1675Help
Entry
Fraau_1675        CDS       T01773                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fau  Frateuria aurantia
Pathway
fau00020  Citrate cycle (TCA cycle)
fau00310  Lysine degradation
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
Module
fau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fraau_1675
  Amino acid metabolism
   00310 Lysine degradation
    Fraau_1675
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fraau_1675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Ribosomal_60s
Motif
Other DBs
NCBI-ProteinID: AFC86086
UniProt: H8KY92
Position
complement(1774204..1775412)
Genome map
AA seq 402 aa AA seqDB search
MSIEVKVPVLPESVSDATIATWHKQVGEAVKRDENLVDLETDKVVLEVPATADGVLKEIL
FKEGDTVNSQQVIAIFEEGAVAAAATAAAPAEAEARTAAAAPAAAGKLDELSPAGRRVAT
EEGIDPSKVTGTGRDGRVTKEDLVNHGKQDSAPAAAAAPAKAAVAPTPGERPEERVPMTR
IRARIAERLMQAKNSTAMLTSFNEVNLAEVSKLRKSLGEQFQKEYGVKLGFMSFFVKAAA
EALKRYPVINASVDGSDVVYHGYQDISIAVSTDKGLVTPVLRDTQNLSFAEIEQGIVNYA
KKAREGKLGLDDLQGGTFTITNGGTFGSLLSTPIINPPQSAILGMHTIKERPVVENGQIV
AAPMMYLALSYDHRIIDGRDAVLFLVDIKNQLENPQRMLLGL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcgaagttaaagtgccggttctgccggaatccgtctccgatgccaccatcgcc
acctggcacaagcaggtcggtgaagccgtgaagcgagacgagaacctggtggatctggaa
accgacaaggtcgtgctggaagtacccgccacggccgacggcgtgctgaaggaaatcctg
ttcaaggaaggcgacacggtcaacagtcagcaggtcatcgcgatcttcgaggaaggcgcc
gtggctgccgccgcaacggccgctgcaccggcagaggctgaagccagaactgccgccgct
gcaccggcagccgccggcaagctggacgagctgtcccccgccggtcgccgcgtcgccacg
gaggaaggtatcgacccgtccaaggtcaccggcaccggtcgtgacggccgggtgaccaag
gaagatctggtcaatcacggcaagcaggattccgcaccggcggccgctgccgcgccggcc
aaggcagccgtggctccgaccccaggcgagcgccctgaagagcgcgtgccgatgacgcgc
atccgcgcccgcatcgccgagcgcctgatgcaggccaagaacagcaccgcgatgctgacc
tccttcaacgaggtgaatctggccgaggtcagcaagctgcgcaaatccctgggcgaacag
ttccagaaggaatacggcgtcaagctgggcttcatgagcttcttcgtcaaggccgccgcc
gaagccctcaagcgctacccggtgatcaatgcctcggtcgacggcagcgacgtggtctat
cacggctatcaggatatctcgatcgcggtgtccaccgacaagggtctggtgaccccggtg
cttcgcgacacacagaatctcagcttcgccgagatcgagcagggcatcgtgaactacgcc
aagaaggcccgcgagggcaagctgggcctggatgatctgcagggcggcaccttcaccatc
accaatggcggcaccttcggctccctgctgtcgacccccatcatcaatccgccgcagagc
gcgatcctgggcatgcacaccatcaaggaacgcccggtagtggaaaacggccagatcgtg
gccgcaccgatgatgtatctggccttgagctacgatcaccgcatcatcgacggtcgcgat
gccgtgctgttcctggtcgacatcaagaaccagctggaaaacccgcagcggatgctgctg
ggactgtaa

DBGET integrated database retrieval system