KEGG   Frateuria aurantia: Fraau_1688Help
Entry
Fraau_1688        CDS       T01773                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
fau  Frateuria aurantia
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_1688
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Fraau_1688
Enzymes [BR:fau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Fraau_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793608..1794609
Genome map
AA seq 333 aa AA seqDB search
MIGLAGTGLAAVERSWLTAHGVSGVILFARNYTSREQLQALVESIREIAGEDFLIAVDHE
GGPVQRFREGFTALPALASLGAAWDRAPGEAVQLAEEHAWLMASELRACGIDFSFAPVAD
LARGNAAIGRRAFHADPEVTAELVQAYMRGLHLGGTAAVLKHFPGHGSVQADTHVAMAVD
PRPLELIRRDDLRPFAEAIMMRAEAVMMAHVVYPDVDGRPAGYSRRWIGEVLRGELGFKG
IVFSDDISMAAAGEAGDVAARVGAHLDAGCDLVLACFPEVVPDAIAAVADRVCLSAERLA
PLRGAVASTWAGLLDNPQRQRFIARVTALESLS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtctggccggcaccgggctggccgccgtcgagcgatcatggctgaccgcgcat
ggcgtcagcggcgtgatcctgttcgcccgcaactacaccagtcgtgagcagttgcaggcg
ctggtggagtcgatccgcgagattgccggcgaagattttctgatcgcggtggatcatgag
ggcggtccggtccagcgtttccgcgagggctttaccgcgctgccggccctggccagtctg
ggggccgcatgggatcgcgcaccgggcgaggccgtgcagctggccgaggagcatgcctgg
ctgatggccagcgaactgcgtgcctgcggcatcgacttcagttttgcgccggtggctgat
ctggcgcgcggcaatgctgccatcggtcgacgtgcctttcatgccgatccggaagtgacg
gccgagctggtccaggcctacatgcgcggcctgcatctgggcggtaccgctgccgtgctc
aaacattttcccggccatggctcggtgcaggccgatacgcatgtggcgatggcggtggat
ccgcggccgctggagctgatccggcgggatgacctgcgccccttcgccgaggcgatcatg
atgcgggccgaggctgtgatgatggcccatgtggtctatcctgacgtcgatggccggccg
gccggctattcaagacgctggatcggcgaggtgctgcgcggcgagctgggcttcaagggc
atcgtcttcagcgatgacatcagcatggcggcggccggcgaggcaggtgatgtcgctgcg
cgtgtcggtgcccatctggatgcgggctgcgatctggtgctggcctgctttcccgaagtg
gtgcccgacgcgatcgcggctgtcgccgaccgcgtatgtttgtcagccgagcgcctggca
cccttgcgcggagccgtggcatcgacctgggccggtctgctggacaacccccagcggcaa
cgttttattgcgcgggtgactgcgctcgaatccctatcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system