KEGG   Frateuria aurantia: Fraau_1718Help
Entry
Fraau_1718        CDS       T01773                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fau  Frateuria aurantia
Brite
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fraau_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1830554..1831999
Genome map
AA seq 481 aa AA seqDB search
MGNILKKIILSLVVLGLAAYGGSVAYLQHWDHATAPQLPANSPTRNDPVALAAFNSLREA
RCDFCHATHTELPFYFHVPLANQLMSKDVSEGLRHFRIEPVLSALQEGKPVNEEQLGRIE
EVISQGRMPPDLYVFMHWHAHLNAQQNQAVLSWVQQERRQHYAMPGVASDHAADPIQPVP
ASLPVNAEQVALGQKLFFDKQLSGDGTLNCASCHDLQHGGVDHLVTATGIHGQKGPINVP
TVYNAVFNVLQFWDGRAKDLADQAAGPVMNPLEMGSHDWNDVAARLNRDPAYAAQFQSAF
GSPVIDQRSVTSAIAAYETTLITPDSRFDKYLKGDAQAINAEEKHGYELFKQVGCSGCHN
GVAVGGGAFEVMGLEGNYFGDRGGQLTAADAGRIGVTKDPLDDHRFKVPTLRNVALTAPY
FHDGSAKTLEQAVREMARYQTPDHNMSDADVHAIVAFLNTLTGTYQGKSLATDDSQAATA
K
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggggaatatattgaaaaagatcattctgagcttggtggtattgggtctggccgcctac
ggcggctcggtcgcctatctgcaacactgggaccatgccaccgcaccgcagttgcctgcg
aactcgccgacacgtaacgatcccgtggcgctggcggccttcaattcgctgcgcgaagcc
cgctgtgacttctgccatgccacccataccgagctgccgttctatttccatgtgccgctt
gccaaccagttgatgagcaaggatgtttccgaaggtctgcgtcacttccggatcgagccg
gtgctgtcggccctgcaagaaggcaagccggtcaatgaagagcagctcggccgcatcgag
gaagtgatcagtcaggggcgcatgccgcctgatctctatgtgttcatgcattggcatgcc
catctgaacgcccagcagaaccaggccgtgctgagctgggtacagcaggagcgtcgtcag
cactatgcgatgccgggcgtggccagcgatcacgccgccgatccgatccagccggttccg
gcctcgctgccggtcaatgccgagcaggtcgcgctgggccagaagctgttcttcgacaag
cagttgtccggtgacggtaccctgaattgcgccagctgccacgatctgcaacacggtggt
gtcgatcatctggtgacggccacgggtatccacggccagaagggcccgatcaatgtgccc
accgtgtacaacgccgtattcaacgtgttgcagttctgggacggacgcgccaaggacctg
gctgatcaggctgcgggtccggtgatgaatccgctggagatggggtcgcacgactggaac
gatgtcgccgcccgactgaatcgggacccggcctacgccgcccagttccagagcgccttc
ggcagcccggtgatcgatcagcgcagcgtcacctcggccatcgccgcctatgaaaccacc
ctgatcacccctgattcgcgattcgacaaatatctgaagggtgatgcccaggccatcaat
gccgaagagaagcatggctacgagctgttcaagcaggtcggctgctcgggctgccacaat
ggtgtcgccgtcggtggcggggctttcgaagtgatggggctggaaggcaactacttcgga
gatcgcggcggccagctgactgcggcggacgccggccgcatcggtgtcaccaaggatccg
ctggatgaccatcgcttcaaggtgccgaccctgcgcaatgtggccctgaccgccccgtac
ttccatgacggcagtgccaagactctggagcaggccgtgcgcgagatggccagataccag
acgccggatcacaacatgtccgatgccgacgtgcatgccatcgtggctttcctgaacacc
ctgacgggtacctaccagggcaagtcgctggcgactgacgacagccaggcggcaactgcc
aagtaa

DBGET integrated database retrieval system