KEGG   Frateuria aurantia: Fraau_1776Help
Entry
Fraau_1776        CDS       T01773                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_1776
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1776
   00052 Galactose metabolism
    Fraau_1776
   00500 Starch and sucrose metabolism
    Fraau_1776
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_1776
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fraau_1776
   00524 Butirosin and neomycin biosynthesis
    Fraau_1776
Enzymes [BR:fau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fraau_1776
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1885572..1886603
Genome map
AA seq 343 aa AA seqDB search
MEPPKSGLKPSSRLTSCFVVADVGGTHARLALAVGDVPHGRLLEATIRRYVCADWPSLEA
IVADYLKRIAPLHPVAGLVCAIAGYLQDDKVINRNLPWTVSRQALVAGFGQRPVWLINDF
EALAYATLTLGVDELVPMIEPFRSSSSPAGTRVVLGPGTGLGSAILIEAGDRVQVLPSEA
GQMAMAPGAGRELQLFELFSRRGSYVTYEHVLSGPGLLATYQGLCELDGQQASVFSAPEV
SRLALAETEPLAVEAMDIFCGLLGSLMADLALLLGATGGIYLGGGFVPELLAFLPRSSFR
QRFFNKGVMQSYLQQIPVWGMQPAEYGMRGAAAMVGLGLIPVV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaacctccgaaatccggcttgaagccttcttcccggctgacatcctgcttcgtggtg
gccgatgtcgggggtactcatgcccgtctggccttggctgtaggggatgtgccacatggc
cgcttgctggaagctacgatccgtcgttatgtctgcgctgattggccgagccttgaagcc
atcgtggcggactatctgaagcggatcgcgccgctccatccggtagccgggctggtctgt
gccatcgcgggctatctgcaggatgacaaggtcatcaatcgcaatctgccctggacggtc
tcccgacaggcgttggtggccggtttcgggcagcgcccggtctggctgatcaatgacttc
gaggcgctggcctatgccaccttgacgcttggggtcgacgagctggtgccgatgatcgag
cctttccggtcgagcagcagcccggctgggactcgcgtcgtgctgggaccggggacgggg
ctgggcagtgctatcctgattgaagcaggcgatcgcgttcaggtgctgccctccgaagcc
ggccagatggcgatggcgccgggggcgggacgtgagctgcagttgttcgaactgttttcc
cgccgtggcagctatgtcacttatgagcatgtgctgtcgggacccggcttgctggcgacc
tatcagggcttgtgcgaactcgatggtcagcaggcaagcgtattcagcgcgccggaggtg
agtcggcttgcgcttgccgagaccgagcctttggcggtggaggccatggacatcttctgc
ggtctgctgggcagcctgatggccgatctggcgctcttgctgggagcaacgggaggcatc
tatctggggggcggctttgtgcccgagttgctggcgttcctgccgcggagttcgttccgg
caacgattcttcaacaaaggcgtgatgcaaagctatctgcaacagattccggtttggggt
atgcagccagcagaatatggcatgcgtggtgcggcggcgatggtcggactgggcctgatt
cccgtcgtttga

DBGET integrated database retrieval system