KEGG   Frateuria aurantia: Fraau_1991Help
Entry
Fraau_1991        CDS       T01773                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_1991
   01230 Biosynthesis of amino acids
    Fraau_1991
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1991
   00051 Fructose and mannose metabolism
    Fraau_1991
   00562 Inositol phosphate metabolism
    Fraau_1991
Enzymes [BR:fau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fraau_1991
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fraau_1991
  Exosomal proteins of bladder cancer cells
   Fraau_1991
  Exosomal proteins of melanoma cells
   Fraau_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2113231..2113998)
Genome map
AA seq 255 aa AA seqDB search
MRKKLVAGNWKMHGSQALTRELCAATAAAKPQDVDVVVFPPSLYLREAVQVLAAGGAVGV
GAQDVSIHAGEGAYTGEISAAMVADCGAGWAIVGHSERRADFRESDHDVGRKFSAARQAG
LKPVLCVGETHADHVAGRTLEVIERQLAAVLDHNPIEAFVSAVIAYEPVWAIGSGLSATP
EQAQQVHAFIRSQIRKKDANISPLTRLLYGGSVKAVNAAELFAQPDVDGGLVGGASLNAE
EFASICQAAGRQDKR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaacttgtcgcgggtaattggaagatgcatggcagtcaggccctgactcgg
gagctgtgcgcggccaccgcggcagccaagcctcaggatgtcgacgtggtagtgtttcct
ccctcgctttacttgcgcgaagcggtgcaggtcttggctgcgggcggggcggtcggtgtc
ggtgcccaggatgtcagcatccatgccggggagggcgcctataccggcgaaatttcggcc
gccatggtcgcggattgcggtgccggctgggccatcgtcggacattcggaacgtcgggcc
gacttccgagaaagcgatcatgacgtcggtcgcaagttctcggcggctcgccaagctggc
ttgaagcccgtgctctgcgtcggggagacgcatgccgatcatgtggcgggccgtacactg
gaagtgatcgagcgccaattggccgccgttctggatcacaatcccatcgaagcttttgtt
tcggcagtgattgcttacgaaccggtctgggccattggcagtggtctcagtgccaccccg
gagcaggcacagcaagtccatgcatttatccgtagccaaatccggaaaaaggatgctaat
atctcccctctgacccggctgctttatggcggcagcgtcaaggcagtcaacgccgctgag
cttttcgcccagccggatgttgatggcgggctcgtcggtggcgcttcattgaatgccgaa
gaattcgccagtatctgtcaggcggcggggagacaagacaagcgttag

  All links  
No link information was found.   
DBGET integrated database retrieval system