KEGG   Frateuria aurantia: Fraau_1991Help
Entry
Fraau_1991        CDS       T01773                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fau  Frateuria aurantia
Pathway
fau00010  Glycolysis / Gluconeogenesis
fau00051  Fructose and mannose metabolism
fau00562  Inositol phosphate metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
fau01230  Biosynthesis of amino acids
Module
fau_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_1991
   00051 Fructose and mannose metabolism
    Fraau_1991
   00562 Inositol phosphate metabolism
    Fraau_1991
Enzymes [BR:fau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fraau_1991
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fraau_1991
  Exosomal proteins of bladder cancer cells
   Fraau_1991
  Exosomal proteins of melanoma cells
   Fraau_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFC86377
UniProt: H8L1W6
Position
complement(2113231..2113998)
Genome map
AA seq 255 aa AA seqDB search
MRKKLVAGNWKMHGSQALTRELCAATAAAKPQDVDVVVFPPSLYLREAVQVLAAGGAVGV
GAQDVSIHAGEGAYTGEISAAMVADCGAGWAIVGHSERRADFRESDHDVGRKFSAARQAG
LKPVLCVGETHADHVAGRTLEVIERQLAAVLDHNPIEAFVSAVIAYEPVWAIGSGLSATP
EQAQQVHAFIRSQIRKKDANISPLTRLLYGGSVKAVNAAELFAQPDVDGGLVGGASLNAE
EFASICQAAGRQDKR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaagaaacttgtcgcgggtaattggaagatgcatggcagtcaggccctgactcgg
gagctgtgcgcggccaccgcggcagccaagcctcaggatgtcgacgtggtagtgtttcct
ccctcgctttacttgcgcgaagcggtgcaggtcttggctgcgggcggggcggtcggtgtc
ggtgcccaggatgtcagcatccatgccggggagggcgcctataccggcgaaatttcggcc
gccatggtcgcggattgcggtgccggctgggccatcgtcggacattcggaacgtcgggcc
gacttccgagaaagcgatcatgacgtcggtcgcaagttctcggcggctcgccaagctggc
ttgaagcccgtgctctgcgtcggggagacgcatgccgatcatgtggcgggccgtacactg
gaagtgatcgagcgccaattggccgccgttctggatcacaatcccatcgaagcttttgtt
tcggcagtgattgcttacgaaccggtctgggccattggcagtggtctcagtgccaccccg
gagcaggcacagcaagtccatgcatttatccgtagccaaatccggaaaaaggatgctaat
atctcccctctgacccggctgctttatggcggcagcgtcaaggcagtcaacgccgctgag
cttttcgcccagccggatgttgatggcgggctcgtcggtggcgcttcattgaatgccgaa
gaattcgccagtatctgtcaggcggcggggagacaagacaagcgttag

DBGET integrated database retrieval system