KEGG   Frateuria aurantia: Fraau_1996Help
Entry
Fraau_1996        CDS       T01773                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
fau  Frateuria aurantia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2117818..2118735)
Genome map
AA seq 305 aa AA seqDB search
MSDPAWDNSPSMDCGGRVVVLDRPCVVGIVNVTPDSFSDGGRFDSLDKAVAHGLALAEAG
AGMLDIGGESTRPGAPAVSLDEELSRVIPVIEALAARCSLPLAIDTHKPEVMRAAAAAGV
GMINDIYALRREGALEAVADLGLPVCIMHMQGEPGTMQQAPDYSDVVGEVQRFLAERLLA
CEFAGIDKRKVLVDPGFGFGKSVEHNLQLLSHLQQFQDMAGGLYVGLSRKSVLGAVTGRA
APAQRAAASVAAALIAAQRGARWIRVHDVAETVDALAVWAAVAGHDRAAASVSTRPAAPV
WPDDD
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatccggcctgggacaacagcccctcgatggattgcggtggccgcgtggtggtg
ctggatcgcccttgcgtggtcggcatcgtcaatgtcacgccggattcgttctcggatggt
gggcgcttcgattccctggacaaggccgtggcccatggactggctctggccgaggctggc
gccggcatgctggacatcggcggcgagtcgacccgtccgggtgcaccggcggtttcgctg
gatgaagagctttcccgggtgattccggtgatcgaggccctggccgcgcgctgctccctg
ccattggcgatcgatacccacaagcccgaggtgatgcgcgccgcggctgcggcgggcgtc
ggcatgatcaacgacatctatgccttgcgccgcgaaggcgctttggaggccgtcgccgac
ctgggcctgccggtatgcatcatgcacatgcagggcgagcccggcaccatgcagcaggct
ccggattacagcgatgtggttggtgaagtgcagcgctttctggccgagcgactgctggca
tgcgagtttgctggcatcgacaagcgcaaggtactggtcgatccaggcttcggtttcggc
aagtcggtggagcacaatctgcagttgctgagccatttgcagcaatttcaggatatggcg
ggtggtctgtatgtcggtctttcacgcaaatccgtgctgggtgcggtgaccggtcgtgcg
gcgcccgcgcaacgggcggcggcttcggtggcggcggcactgatcgctgcgcagcgtggt
gcacgctggatccgggttcatgacgtggccgaaaccgtggatgcgctggcggtgtgggca
gcggtagccggacatgatcgcgccgcagccagtgtttcgacccggccggccgcaccggtg
tggccggatgatgattga

DBGET integrated database retrieval system