KEGG   Frateuria aurantia: Fraau_2033Help
Entry
Fraau_2033        CDS       T01773                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
fau  Frateuria aurantia
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Fraau_2033
   00052 Galactose metabolism
    Fraau_2033
   00500 Starch and sucrose metabolism
    Fraau_2033
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_2033
Enzymes [BR:fau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Fraau_2033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2159721..2160596)
Genome map
AA seq 291 aa AA seqDB search
MSKRLRKVVFPVAGLGTRFLPATKVVAKEMLPVLDRPLIQYAVDEAVDAGADTLIFVTNR
YKHSIADYFDKAYELEAKLEEKGKAELLALVQGTLPSHVRAIFVTQPEARGLGHAVLCAK
PVVGDESFGVILPDDLIWNEGRGALGQMADLAEREHAGVIAVEEVPREETDKYGVVDAAP
IDERSARISHMVEKPRPEDAPSNLAVVGRYVLPSTIFHYLETTQPGAGGEIQLTDALEAL
LQNKGKMLAYRFQGTRFDCGNKAGLVRATVHMALNDPKLAPEVRQYLKEVV
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaagcgtctacgcaaagtggtgtttcccgtcgccggactcggcacccggtttctg
ccggcgaccaaggtggtggccaaggaaatgctgccggtactggatcggccgctgatccag
tatgccgtcgatgaagccgtcgatgcgggtgccgataccctgatcttcgtcaccaaccgc
tacaagcactccattgccgactatttcgacaaggcctacgagctggaggccaagctcgag
gagaagggcaaggccgaactgctggccctggtccagggcaccttgcccagccatgtgcgt
gccatcttcgtgacccagccggaagcgcggggcctgggccatgcggtgctgtgcgccaag
ccggtggtcggtgacgagtccttcggcgtgattctgccggacgatctgatctggaatgag
gggcgtggcgccctgggccagatggcggatctggccgaacgtgagcatgccggcgttatc
gcggtggaagaggttccgcgcgaggaaaccgacaagtacggcgtggtcgatgctgcccct
atcgatgagcgcagtgcccgcatcagccatatggtggaaaagcccaggcccgaggatgct
ccgtccaatctggccgtggtcggtcgctatgtgttgccctcgaccatcttccattatctg
gaaaccacccagcccggtgctggcggcgagatccagctgaccgacgcgctggaagccctg
ctgcagaacaagggcaagatgctggcgtatcgttttcagggcacccggttcgattgcggc
aacaaggccggactggtccgcgccacggtgcatatggcgctgaacgatcccaagctggct
cccgaggtgcggcagtacctgaaggaagtggtctga

DBGET integrated database retrieval system