KEGG   Frateuria aurantia: Fraau_2043Help
Entry
Fraau_2043        CDS       T01773                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fau  Frateuria aurantia
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fau00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fraau_2043
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Fraau_2043
Enzymes [BR:fau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Fraau_2043
Two-component system [BR:fau02022]
 CheA family
  CheA-CheYBV
   Fraau_2043
Bacterial motility proteins [BR:fau02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Fraau_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2170735..2171865)
Genome map
AA seq 376 aa AA seqDB search
MNSHDPARKIKVLVIDDSALVRKLLTMMLEQDPAIEVVGTASDPYIARDKIKRLAPEVLT
LDVEMPGMDGLTFLENLMRLHPLPVVMVSSLTSDGADTTLRALELGAVDFFEKPHHDLSE
TLTVLAPQLAAKIHAAAGSRPRASTLAAPPPKLSADAVLPKRPSFSGIPGDSPVIAIGAS
TGGTEAIRVVLESMPPDAPPIVITQHIPAAFSAPFAARLDRCSPMRVVQAEDGQHLMPGH
AYVAPGDRHLIVIRDGARLVCRLHDGPAVGRHKPSVDVMFRSVAMCTGDRAVGALLTGMG
DDGARGLLEMREAGALTVAQDQASSVVWGMPGSAWKMQAASELVSIDQMAARLLALVASM
GPHTFAKASDAVRGQG
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtcacgaccccgcccgcaagatcaaagtgctggtgatcgatgattcggccctg
gtccgcaaattgctgaccatgatgctggagcaggatcccgccatcgaagtcgtcggcacc
gcttccgatccctatattgcgcgtgacaagatcaagcgcctggcccctgaggtattgacc
ctcgatgtcgaaatgcccggcatggacgggctgacctttctcgaaaatctgatgcggctg
catcccttgccggtggtgatggtttcatcgctgaccagcgatggcgcggataccaccttg
cgcgcgctggagctgggcgcggtggatttcttcgagaagccgcaccacgatctgtccgag
acgctgaccgtgctggcgccgcagctggcggcgaaaatccatgccgcggcgggatccagg
ccgcgtgccagcaccttggcggcaccgccgccgaagctgagcgcggatgcggtgctgccg
aagcgtccttccttcagcggcattcccggcgacagtccggtgatcgcgatcggagcttcc
accggcggtaccgaagcgatccgcgtcgtattggaatcgatgccgccggatgcgccgccg
atcgtgatcacccagcatattccggcggccttcagcgcacccttcgcagcccggctcgat
cgctgctctccgatgcgggtggtccaggccgaggacggtcagcatctgatgcccggtcac
gcctatgtcgcgccgggtgatcgccacctgatcgtgatccgtgacggagctcggttggta
tgccgtttgcacgacggcccggccgtcggccggcacaagcccagcgtggatgtgatgttc
cgttcggtggcgatgtgcaccggggaccgtgcggtcggtgcgctgttgaccgggatgggt
gacgacggggcgcgcggcctgctggagatgcgcgaggccggtgcgttgacggtggcacag
gaccaggccagttcggtggtctggggcatgcccggttccgcctggaagatgcaggcggct
tcggaattggtatccattgatcagatggcggcacgtttgctggcgctggtggcctcgatg
gggccgcacacattcgccaaggcgtcagatgcagtacgagggcagggctga

DBGET integrated database retrieval system