KEGG   Frateuria aurantia: Fraau_2174Help
Entry
Fraau_2174        CDS       T01773                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fau  Frateuria aurantia
Pathway
fau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01130  Biosynthesis of antibiotics
fau01230  Biosynthesis of amino acids
Module
fau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fraau_2174
Enzymes [BR:fau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Fraau_2174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFC86556
UniProt: H8L480
Position
complement(2302109..2302903)
Genome map
AA seq 264 aa AA seqDB search
MSDILERILARKVEEVAERHERLPLADLAARIPHLPLTRGFAAAMESRIHHGRPAVIAEV
KKASPSKGVIRPDFDPAAIARSYEEGGACCLSVLTDVDFFQGSDAYLRQARAACELPILR
KDFVIDPYQVYESRVLGADCILLIVAALDDEKLMELALLAAELDLDVLCEVHDQAELERA
LQLPVPLLGINNRNLRTFETSLDTTLMLRDQVDDERILVTESGIHTPEDVARMRLEGVHA
FLVGEAFMRAPDPGSELQRLFGQL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatattcttgaacgtattctggcccgcaaggtggaggaggtggccgagcgccac
gagcgtctgccgctggccgatctggcagcccgcataccgcatctgccgttgacccgcggc
tttgcggccgcgatggagtcccgcatccaccacggccgcccggccgtgatcgccgaggtc
aagaaggccagccccagcaagggtgtgatccggccggatttcgatccggcggccattgcg
cgcagttatgaagaaggcggcgcctgctgtctgtcggtactgacggatgtggattttttt
cagggcagtgatgcctatctgcgccaggccagggccgcctgcgagctgccgatcctgcgc
aaggacttcgtgatcgacccctaccaggtctatgaatcgcgggtgctgggtgctgattgc
attttgctgatcgtggctgctctggatgatgagaagctgatggagctggcgttgctggcc
gccgagctggatctggacgtgttgtgcgaagtgcatgatcaggccgagctggagcgggcg
ctgcagctgcccgtacctttgctgggcatcaacaatcgcaatctgcgcacttttgaaact
tcgctggacacgacgctgatgctgcgcgatcaggtggacgatgagcggatcctggtcacc
gagtccggcatccatacaccggaagatgtcgcccgcatgcggcttgaaggggtgcatgcc
tttctggtcggcgaggccttcatgcgcgcgccggatccgggcagtgaactgcagcggttg
ttcggccagctctga

DBGET integrated database retrieval system