KEGG   Frateuria aurantia: Fraau_2225Help
Entry
Fraau_2225        CDS       T01773                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fau  Frateuria aurantia
Pathway
fau00071  Fatty acid degradation
fau00280  Valine, leucine and isoleucine degradation
fau00310  Lysine degradation
fau00362  Benzoate degradation
fau00380  Tryptophan metabolism
fau00620  Pyruvate metabolism
fau00630  Glyoxylate and dicarboxylate metabolism
fau00640  Propanoate metabolism
fau00650  Butanoate metabolism
fau00900  Terpenoid backbone biosynthesis
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
fau01212  Fatty acid metabolism
fau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fraau_2225
   00630 Glyoxylate and dicarboxylate metabolism
    Fraau_2225
   00640 Propanoate metabolism
    Fraau_2225
   00650 Butanoate metabolism
    Fraau_2225
  Lipid metabolism
   00071 Fatty acid degradation
    Fraau_2225
   00072 Synthesis and degradation of ketone bodies
    Fraau_2225
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Fraau_2225
   00310 Lysine degradation
    Fraau_2225
   00380 Tryptophan metabolism
    Fraau_2225
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Fraau_2225
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Fraau_2225
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fraau_2225
Enzymes [BR:fau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Fraau_2225
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fraau_2225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFC86602
UniProt: H8L4P7
Position
2357663..2358961
Genome map
AA seq 432 aa AA seqDB search
MSSPSFAPPAARRVAILGGNRIPFARANTAYAQASNQDMLTAALQGLVDRFKLSGERLGE
FAAGAVLKHSRDFNLARETLMSTTLSPETPAYDIQQACGTGLEAAILVANKIALGQIEVG
IAGGVDTASDAPIAINEKLRKILLKANRARDLGGRLKAFSALRPDMFFKPQLPRNGEPRT
GLSMGQHCELMAKYWDIPRAAQDELALRSHHNLAAAYDRGFFDDLITPFRDLKRDNNLRA
DSTLEKLASLKPAYDRQAGTLTAGNSTPLTDGASTVLLASEEWAKAHDLPVLAWLRTGET
AAVDFASGKEGLLMAPAYAVPRMLAREGLSLQDFDLYEIHEAFAAQVLCTLKAWESPDFA
RNRLGLEAPLGAIDQSKMNINGGSLGTGHPFAATGGRILAGLAKELAQRGSGRGLISICA
AGGLGVVAIIER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagttcgccttcatttgcgccccccgcggcccgccgggtcgctattctgggcggcaac
cggattccgtttgcccgcgccaataccgcctatgcccaagccagcaatcaggacatgctg
accgccgcgctgcaaggcctggtggatcgcttcaagctgagtggcgaacggctgggcgaa
ttcgccgccggtgccgtgctcaagcattcgcgcgatttcaatctggcccgcgaaactctg
atgtcgaccaccctgtcgccggaaaccccggcctacgacatccagcaggcctgcggcacc
ggcctggaagcggccatcctggttgccaacaagatcgccctcggccagatcgaggtcggc
attgccggcggtgtcgacacggcctcggatgcgcccatcgccatcaacgagaagctgcgc
aagatcctgttgaaagccaaccgggcccgcgatctcggcggccggctgaaagccttttcg
gcactgcgtcccgatatgttcttcaagccgcagctgccccgcaacggcgagccgcgcacc
ggcctgtcgatgggccagcactgcgaattgatggccaaatactgggatatcccgcgtgcc
gcccaggatgaactggcgctgcgcagccaccacaatctggcggcggcttacgatcgcggc
ttcttcgacgacctgatcaccccgttccgcgacctgaagcgcgacaacaatctgcgggcg
gacagcacgctggagaagctggccagcctgaaacccgcctatgaccgccaagccggcacg
ctgaccgccggcaattccacgccgctgaccgatggcgcctccaccgtgctgctggccagc
gaggagtgggccaaggcccatgacctgccggtgctggcctggctgcgcaccggcgaaacc
gccgccgtggactttgccagcggcaaggaaggtctgctgatggcaccggcctatgcggtg
cctcggatgctggctcgggaaggcctgagcctgcaggattttgacctgtacgagatccac
gaagcctttgccgcccaggtactgtgcacgctgaaggcctgggagtcgccggatttcgcg
cgcaaccggctgggcctggaggcgccgctgggcgcgatcgaccagagcaagatgaacatc
aacggcggctcgctgggtaccggccatccgtttgccgcgaccggcggacggattctggcc
ggcctggccaaagagctggcccagcgtggcagcggtcgcggactgatttcgatctgtgcc
gccggcggtctgggcgtggtcgccatcatcgagcgctga

DBGET integrated database retrieval system