KEGG   Frateuria aurantia: Fraau_2317Help
Entry
Fraau_2317        CDS       T01773                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fau  Frateuria aurantia
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fau00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2454346..2455185)
Genome map
AA seq 279 aa AA seqDB search
MSDWMTAEPRLRLLAALARQAGAAILEVYARPFEVHEKADHSPVTAADLAAQTVIVAGLQ
AIAPALPVVSEEAVNADWEQRRHWSSYWLVDPLDGTREFVKRNGEFTVNIALIENHQPLL
GVVLAPVTGALYLAGRGFGAWTQSGPEGSWMPLRSRPLARPATVTGSRSYERAQPAELEQ
VAGAGYASMAMGSSLKFCLIADGQADIYLRLGATSEWDTAAAQCVLEEAGGAVLDLSGQR
LRYNRGLSLINPEFIAVGDGGVDWDARLRNLRRIRGAEA
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactggatgacggccgaaccccggttgcggctgctggcggcgctggcccgccag
gccggggcggcgatactcgaggtctacgcccggcctttcgaggttcacgaaaaggccgat
cattcgccggtgacggcggccgatctggccgcccagaccgtgatcgtggccggcctgcag
gccatcgcgccggccctgccggtagtctccgaagaggcagtcaatgccgactgggagcag
cgtcggcactggtccagctattggctggtcgatccgctggacggcacgcgcgagttcgtc
aagcgcaatggcgagttcaccgtcaatatcgccctgatcgagaaccaccagccgctgctg
ggggtggtgctggcgccggtgaccggagccttgtatctggccgggcgtgggttcggcgcc
tggacacagtcggggccggaaggttcctggatgcctctgcgcagccgccccttggcccgt
cctgcgacagtgaccggcagccgctcctatgagcgggcgcagccggcggaactcgagcag
gtggccggcgccggttatgccagcatggcgatgggctcgtctctgaagttctgcctgatc
gcggatggccaggcggatatctatctgcggctgggcgccacttcggagtgggatacggcg
gccgcgcaatgcgtactggaagaggccggtggcgcggtgctggatctttccgggcagcgt
ctgcgctacaaccgtggtctctcgctgatcaatcccgaattcatcgcggtgggcgatggg
ggtgtcgactgggatgcccggctgcgcaacctgcgtcgtatccgcggcgccgaggcctga

DBGET integrated database retrieval system