KEGG   Frateuria aurantia: Fraau_2357Help
Entry
Fraau_2357        CDS       T01773                                 

Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fau  Frateuria aurantia
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fraau_2357
Enzymes [BR:fau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Fraau_2357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505361..2506521)
Genome map
AA seq 386 aa AA seqDB search
MSDVGGREDVSGGRRRALVWLATGALLSSTGPVMGLSVAREPLPAWPGWEAFKKAQIQAD
GRVIDYITTDLRSTSESQAYAMFFALVANDKLMFASVWHWTRHNLMPGSAPITLPGWLWG
RSASGGYRLLDGNSASDADLWMAYALLEAGRLWRREDYSAAGHALLQLIQVHEAARIPGL
GPMLLPGRLGFAGTGWWKLNPSYLPIQVLRRCALELPPSSPWAVYPHQALRLIQLSAVQG
FVADWVRWNGSSMQRDVTASWDAIRTYLWAGMLADEDALRAPLLSALHGPLDQLRNGQRM
PEKIHLESGLQEGREPRGYAGALLPYLAVQGQNQLLASQQQQIPPVAQYATTGLPYFERM
LILFGEGWLQHRFRFGPQGHLMPSWA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgtcggtgggcgtgaagatgtcagtggcggcaggcgcagggcgctggtctgg
ttggcgacaggagcgctgctgtccagtaccgggcctgtcatgggcttgagcgtggcgcgg
gagccactgccggcatggccgggctgggaggcattcaagaaggcacagatccaggccgac
ggccgggtcatcgattacatcaccacggatctgaggagcacctccgaatcgcaggcctat
gcaatgttcttcgcgctggtggccaatgacaagctgatgtttgccagcgtctggcattgg
acacgacacaatctgatgccaggcagtgcgccgataaccttgccgggctggctgtggggg
cgctcggcctcgggcgggtatcgcctgcttgacggcaattccgcatccgacgccgatctg
tggatggcttacgccctgctggaggctgggcggctgtggcgacgcgaggattacagtgcc
gccgggcatgctctgttgcaattgatccaggtccatgaggctgcccggattcctggactg
gggcctatgctgctgcctggccgactgggttttgccggtacaggctggtggaagctcaac
cccagttatctgccgatccaggtgctcaggcgttgcgccctcgagctgccgccatcaagt
ccgtgggcggtatacccgcatcaggcgctgcggttgatccagctcagtgccgttcaaggg
tttgtggcggactgggtccgctggaatggctcgagcatgcagcgggacgtcaccgcaagt
tgggacgccattcgcacctatctgtgggctggcatgctggctgatgaagatgccttgcgc
gcgcccctgctgtctgccttgcacggaccgttggatcaattgcggaacgggcagcggatg
ccggaaaaaatccatctggaaagcggactgcaggaaggccgcgagccgcgtggctatgcc
ggtgcattgttgccgtatcttgccgtccagggacagaatcagttgcttgcaagccagcag
cagcagattccgcctgtggcgcaatatgcgaccaccggattgccttacttcgaacgcatg
ctgatcctgttcggtgagggatggctgcagcatcgcttccgcttcggtccgcaaggacat
ctgatgccgagttgggcttga

DBGET integrated database retrieval system