KEGG   Frateuria aurantia: Fraau_2357Help
Entry
Fraau_2357        CDS       T01773                                 

Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
fau  Frateuria aurantia
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2505361..2506521)
Genome map
AA seq 386 aa AA seqDB search
MSDVGGREDVSGGRRRALVWLATGALLSSTGPVMGLSVAREPLPAWPGWEAFKKAQIQAD
GRVIDYITTDLRSTSESQAYAMFFALVANDKLMFASVWHWTRHNLMPGSAPITLPGWLWG
RSASGGYRLLDGNSASDADLWMAYALLEAGRLWRREDYSAAGHALLQLIQVHEAARIPGL
GPMLLPGRLGFAGTGWWKLNPSYLPIQVLRRCALELPPSSPWAVYPHQALRLIQLSAVQG
FVADWVRWNGSSMQRDVTASWDAIRTYLWAGMLADEDALRAPLLSALHGPLDQLRNGQRM
PEKIHLESGLQEGREPRGYAGALLPYLAVQGQNQLLASQQQQIPPVAQYATTGLPYFERM
LILFGEGWLQHRFRFGPQGHLMPSWA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgatgtcggtgggcgtgaagatgtcagtggcggcaggcgcagggcgctggtctgg
ttggcgacaggagcgctgctgtccagtaccgggcctgtcatgggcttgagcgtggcgcgg
gagccactgccggcatggccgggctgggaggcattcaagaaggcacagatccaggccgac
ggccgggtcatcgattacatcaccacggatctgaggagcacctccgaatcgcaggcctat
gcaatgttcttcgcgctggtggccaatgacaagctgatgtttgccagcgtctggcattgg
acacgacacaatctgatgccaggcagtgcgccgataaccttgccgggctggctgtggggg
cgctcggcctcgggcgggtatcgcctgcttgacggcaattccgcatccgacgccgatctg
tggatggcttacgccctgctggaggctgggcggctgtggcgacgcgaggattacagtgcc
gccgggcatgctctgttgcaattgatccaggtccatgaggctgcccggattcctggactg
gggcctatgctgctgcctggccgactgggttttgccggtacaggctggtggaagctcaac
cccagttatctgccgatccaggtgctcaggcgttgcgccctcgagctgccgccatcaagt
ccgtgggcggtatacccgcatcaggcgctgcggttgatccagctcagtgccgttcaaggg
tttgtggcggactgggtccgctggaatggctcgagcatgcagcgggacgtcaccgcaagt
tgggacgccattcgcacctatctgtgggctggcatgctggctgatgaagatgccttgcgc
gcgcccctgctgtctgccttgcacggaccgttggatcaattgcggaacgggcagcggatg
ccggaaaaaatccatctggaaagcggactgcaggaaggccgcgagccgcgtggctatgcc
ggtgcattgttgccgtatcttgccgtccagggacagaatcagttgcttgcaagccagcag
cagcagattccgcctgtggcgcaatatgcgaccaccggattgccttacttcgaacgcatg
ctgatcctgttcggtgagggatggctgcagcatcgcttccgcttcggtccgcaaggacat
ctgatgccgagttgggcttga

DBGET integrated database retrieval system