KEGG   Frateuria aurantia: Fraau_2402Help
Entry
Fraau_2402        CDS       T01773                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
fau  Frateuria aurantia
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2569579..2570325)
Genome map
AA seq 248 aa AA seqDB search
MLAWAQPQAPTSGPQAVVRQALQAAAPGLKIDSITAAPLPGFQQVIAGGRMVYVRDDGRY
MFDGRLVGLSAPARDLSRPAWNAYRRAQLAAIPAADRIIYAPAKPRYRVTVFTDVTCGFC
RELHRHMAEINQLGIEVDYLAWPREGLLTTAGRPTPVATEMADVWCADDRKAAFEAALMR
ATPPPARSCANPVRREYEAGSRMGANGTPTIIADDGRELGGYLSPESLLQAVRKEAGETV
PAKASPGH
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgctggcatgggcacagccgcaggcgccgacctccggcccgcaggccgtggtgcgccag
gccttgcaggcggcggcgcccggtctgaagatcgactcgatcaccgcggcacccttgccc
ggtttccagcaggtgattgccggcgggcggatggtctatgtccgtgatgacgggcgctat
atgttcgatggccggctggtggggctgtcggccccggcccgcgatctgagccggccggcc
tggaatgcttatcggcgtgcgcagctggcggccattcccgctgccgaccgcatcatctac
gcgccggcgaaaccccgttaccgggtgacggtcttcaccgacgtcacctgcggcttttgc
cgtgaactgcaccggcatatggccgagatcaatcagctcggcatcgaggtcgattatctg
gcctggccgcgcgaaggactgctgaccacggcgggacgaccgacgccggtggccaccgaa
atggccgatgtctggtgcgccgacgatcgcaaggccgctttcgaggccgccctgatgcgg
gctacgccgcctccggcccgatcctgcgccaatccggtacggcgcgaatacgaggcgggc
agccggatgggggccaatggcacgccgaccatcatcgccgatgacgggcgcgagctcggc
ggctatctgagtcctgagtccttgctgcaggcggtgcgcaaggaggccggtgaaaccgtc
ccggccaaggcatcgccggggcattga

DBGET integrated database retrieval system