KEGG   Frateuria aurantia: Fraau_2413Help
Entry
Fraau_2413        CDS       T01773                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
fau  Frateuria aurantia
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:fau00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:fau00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:fau03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:fau03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:fau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2579933..2580355
Genome map
AA seq 140 aa AA seqDB search
MARADFYLIDKPRFRDQPLLLVCELARRAYASQQPTLILVRDEAQAEALDELLWAFDEDA
FIPHQLAGDADDASTAVLIVLPGTTTPDRPLIINLRDEIAGGDYQRVLEVIAADPAERDG
SRQRWRQYQALGLELAKHDM
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgccgatttctatctgatcgacaagccgcgctttcgcgaccagcctttgctg
ctggtctgcgaactggcccggcgagcctacgccagtcagcagccgaccctgatcctggtg
cgtgacgaggcccaggccgaagccttggatgagctgctgtgggccttcgacgaggatgct
ttcatcccgcaccagctcgccggtgatgccgatgacgccagcaccgcggtgctgatcgtg
ctgcccggcaccaccactccggatcgtccgctcatcatcaatctgcgtgacgagatcgcc
ggcggcgattaccagcgggtgctggaagtcatcgccgccgatccagccgagcgcgatggc
tcccgccagcgctggcggcagtatcaggccctcggcctggaactggccaagcacgacatg
tag

DBGET integrated database retrieval system