KEGG   Frateuria aurantia: Fraau_2546Help
Entry
Fraau_2546        CDS       T01773                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fau  Frateuria aurantia
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fau00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710341..2710838)
Genome map
AA seq 165 aa AA seqDB search
MSKVYVGLGANLGRPVRQLRQALTQMSAWPQLHGLRVSSFYRTPPWGLTGQPDFINAVAE
LGTDWSPDRLLAELQRIEAEAGRVRLGERWGPRTLDLDILHVEGVSRSDPDLTLPHPRIA
ERAFVLLPLGELTPELELPGQGQVRALLAAIDTSGCQRLDAAEPD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaggtctatgtggggctgggtgccaatctcggtcgcccggtccggcaactgcgg
caggccttgacgcagatgtcggcgtggccgcaactgcacggcttgcgggtgtcttccttt
taccgcaccccaccctggggactgaccgggcagcctgatttcatcaatgcggtggccgaa
ctgggcacggactggtcgccggaccggctgctggccgagttgcagcggatcgaggccgag
gccggccgggtgcgccttggcgagcgctgggggccgcgcacccttgacctggatatactt
catgtcgagggcgtgtctcggtccgacccggacctgaccttgccgcatcctcgcatcgcc
gagcgggctttcgtcctgctgccgctgggcgagttgacacccgagctggaattgccgggt
cagggtcaggtgcgggccttgctggcggccatcgatacgagtggctgtcagcgtctggat
gccgctgaaccggactga

DBGET integrated database retrieval system