KEGG   Frateuria aurantia: Fraau_2546Help
Entry
Fraau_2546        CDS       T01773                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
fau  Frateuria aurantia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fraau_2546
Enzymes [BR:fau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Fraau_2546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710341..2710838)
Genome map
AA seq 165 aa AA seqDB search
MSKVYVGLGANLGRPVRQLRQALTQMSAWPQLHGLRVSSFYRTPPWGLTGQPDFINAVAE
LGTDWSPDRLLAELQRIEAEAGRVRLGERWGPRTLDLDILHVEGVSRSDPDLTLPHPRIA
ERAFVLLPLGELTPELELPGQGQVRALLAAIDTSGCQRLDAAEPD
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaaggtctatgtggggctgggtgccaatctcggtcgcccggtccggcaactgcgg
caggccttgacgcagatgtcggcgtggccgcaactgcacggcttgcgggtgtcttccttt
taccgcaccccaccctggggactgaccgggcagcctgatttcatcaatgcggtggccgaa
ctgggcacggactggtcgccggaccggctgctggccgagttgcagcggatcgaggccgag
gccggccgggtgcgccttggcgagcgctgggggccgcgcacccttgacctggatatactt
catgtcgagggcgtgtctcggtccgacccggacctgaccttgccgcatcctcgcatcgcc
gagcgggctttcgtcctgctgccgctgggcgagttgacacccgagctggaattgccgggt
cagggtcaggtgcgggccttgctggcggccatcgatacgagtggctgtcagcgtctggat
gccgctgaaccggactga

DBGET integrated database retrieval system