KEGG   Frateuria aurantia: Fraau_2877Help
Entry
Fraau_2877        CDS       T01773                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fau  Frateuria aurantia
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fraau_2877
Enzymes [BR:fau01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Fraau_2877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3098868..3099473)
Genome map
AA seq 201 aa AA seqDB search
MIGRLRGILISRQPPWLLVEVGGGVGYQLEAPMSTIYDLPGLGQEVILLTHYAVKEDSVA
LYGFLRESERSLFRQLQKVSGIGAKIALAVLSAINTADFARLVQLGDVTALTKIPGVGKK
TAERMVVELRDKLDGPLSGAPLAGVPGTAAAALNPVDEAAAALQQLGYKPPEALRLIQKV
AAEGDDVESIIRKALRAALGN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccgtttgcgaggtatcttgatttcccggcagccgccctggctgctggtggag
gtcggtggcggcgtcggctatcagctggaagcgccgatgtcgacgatctacgatctgccg
ggccttggtcaggaagtgatcctgctgacccattacgcggtcaaggaagattcggtggcc
ttgtacggatttctgcgtgaatccgagcgcagcctgttccggcagctgcagaaggtcagc
ggcatcggtgccaagatcgctctggcggtgctttccgcgatcaataccgcggatttcgcc
cgcctggtccagctgggcgatgtcaccgccctcaccaagattcccggcgtgggcaagaaa
accgccgagcgcatggtggtggagttgcgggacaagctggatggccccttgtcgggagcg
ccgctggcaggcgtgcccggaacggccgcagcggcgctgaacccggtcgacgaggccgcc
gccgccctgcagcagctgggctacaaaccgcctgaagcgctgcgcctgatccagaaggtg
gccgccgaaggcgatgacgtcgaatccattatccgcaaggcgctgcgcgccgctctgggg
aattga

DBGET integrated database retrieval system