KEGG   Frateuria aurantia: Fraau_2900Help
Entry
Fraau_2900        CDS       T01773                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fau  Frateuria aurantia
Pathway
fau00020  Citrate cycle (TCA cycle)
fau00640  Propanoate metabolism
fau00660  C5-Branched dibasic acid metabolism
fau01100  Metabolic pathways
fau01110  Biosynthesis of secondary metabolites
fau01120  Microbial metabolism in diverse environments
fau01130  Biosynthesis of antibiotics
fau01200  Carbon metabolism
Module
fau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fraau_2900
   00640 Propanoate metabolism
    Fraau_2900
   00660 C5-Branched dibasic acid metabolism
    Fraau_2900
Enzymes [BR:fau01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Fraau_2900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AFC87231
UniProt: H8L176
Position
complement(3125851..3127014)
Genome map
AA seq 387 aa AA seqDB search
MNFHEYQAKELFAQYAIPVPPGRVATSPDAAVEAAKALGTGPWMVKAQIHAGGRGKAGGV
KFCKSTDEVHAAAAGMLHSRMATYQSAGRALPVNLVLVADAAQIERELYLSVLIDRDAKA
ISFIGSGQGGVDIEQVARESPQDIHTVTVDFVEGLQPYQCRGLGFAMGLNLKQVNQLTRI
MLGLYRLFQDKDLSLIELNPLGVLADGNLVALDGKINSDDNAEFRHPELTALHDPSQEDP
TEAEAARHNLNYVTMDGHIGCMVNGAGLAMATMDVIKLAGGEPANFLDVGGGATRERVAE
AFKLILSSSGVKAILVNIFGGIVRCDLIAEGIVAAVKEVGLKIPVVVRLQGTNVDKGRAL
LAGSGLAIIPADDLNDAARKAVAAVQA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccacgaataccaagcgaaagaactgtttgcccaatacgcgattccggttccg
ccggggcgcgtggcgacctcgccggatgcggcggtcgaggcggccaaggccctggggacg
gggccgtggatggtcaaggcccagatccatgccggtggccgcggcaaggccggtggcgtc
aagttctgcaagtcgacggatgaagtccatgccgcggcggccgggatgctgcacagccgg
atggccacttaccagtcggcgggccgggccctgccggtaaatctggtgctggtggccgat
gcggcgcagatcgagcgcgaattgtatctgtcggtattgatcgaccgcgacgccaaggcg
atatcctttatcggttccggtcagggcggtgtggatatcgagcaggtggcgcgtgaaagc
ccgcaggatatccataccgtgaccgtggatttcgtggaaggcctgcagccttaccagtgc
cgtggtctgggtttcgcgatgggcctgaatctcaagcaggtgaaccagctgacccggatc
atgcttgggctttatcgcctgttccaggacaaggacttgtccctgatcgagctcaacccg
ctgggcgtgctggctgacggcaatctggtcgcgctggatggcaagatcaactccgatgac
aatgccgagttcaggcatccggagctgaccgcgctgcatgatcccagtcaggaggatccg
accgaggccgaagcggccaggcacaatctcaactacgtgaccatggatggccatatcggc
tgcatggtcaatggcgcgggactggcgatggcgaccatggatgtgatcaagctggcgggc
ggcgagccggccaatttcctggatgtcggtggcggggccacgcgggagagggtggccgag
gccttcaagctgatcctgtcctcttcaggcgtgaaggcgatcctggtcaacattttcggt
ggcatcgtgcgctgtgacctgatcgccgagggcattgtcgccgccgtcaaggaggtcggt
ctgaagattccggtggtggtgcggctgcaaggcaccaatgtggacaaggggcgtgccttg
ctggccggctccgggctggcgatcatcccggccgatgatctcaacgatgcggcccgcaag
gccgtcgccgccgttcaggcctga

DBGET integrated database retrieval system