KEGG   Frateuria aurantia: Fraau_2956Help
Entry
Fraau_2956        CDS       T01773                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
fau  Frateuria aurantia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fraau_2956
Enzymes [BR:fau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Fraau_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3202426..3203220)
Genome map
AA seq 264 aa AA seqDB search
MHCQRGESDAAAMAGWTVVLTRPVGKAAGWRRSFQAAGAEVRLLPGLAIRPVPVPAQLVA
QWRASVEDVIWIFTSPVAVEQVWAQNRAWPKGRLMAVGQATAARLQALGSGPVTAPAGRQ
DSEGLLALPDLQQLEGRRIRLVTGVGGRGLLQTELRRRGAEVRELEVYARVAPRLDRRHF
EGVRTLPHRSILLISSAEAMQHLQAGLPSPLWQRLLACPLVVSSSRLERLAEAAGFRIRC
CARSALLPAMLAASEQIALRKGCL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgcactgccaacgaggggagtcggatgctgccgcaatggcgggctggaccgtggtcctg
acccggccggtcggcaaggcggccggatggcgtcgctcgttccaggcggccggcgccgag
gtcaggctgctgccgggcctggcgatccgtcctgtccccgtgccggcacagcttgtggcg
cagtggcgggcttcggtcgaggatgtgatctggatcttcaccagcccggtggcggtcgag
caggtctgggcccagaacagggcctggcccaagggtcggctgatggcggtggggcaggcc
acggcagcgcgtttgcaggcgctgggcagcggcccggtgaccgctcctgcagggcggcag
gacagtgaaggcctgctggcactgccagacttgcagcagctggaggggcgtcgcatccgg
ttggtgaccggtgtcggcggacgcggcttgttgcagaccgaactgcgccggcgtggcgcc
gaggtccgcgagctggaggtctatgcgcgggtggcgccgcgactggaccgacgtcacttc
gagggggtgcgcactttgccgcatcgctcgatcctgctaatttccagtgccgaggccatg
cagcatctgcaggccggattgccgtcccccttgtggcagcgcctgttggcttgtccgctg
gtcgtcagcagttcccgtctggagcgactggccgaggcggcaggattccggattcgctgc
tgtgcccgttcggccttgctgccggccatgctggcggcgagcgaacagatcgccctgaga
aaaggatgcttatga

DBGET integrated database retrieval system