KEGG   Frateuria aurantia: Fraau_2973Help
Entry
Fraau_2973        CDS       T01773                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fau  Frateuria aurantia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fraau_2973
Enzymes [BR:fau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fraau_2973
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3222754..3223356
Genome map
AA seq 200 aa AA seqDB search
MSDEANRPDVSREQAEEAIRTLLLWAGEDPAREGLIDTPKRVVKAYSDWFAGYASDPADY
LLRTFEEVGGYDEMVVLRDIEFESHCEHHMAAIIGKAHIAYLPDNRVVGISKLARVVDGF
ARRLQVQEKMTAQIAQCIQETLQPKGVAVVIEAAHECMTTRGVHKRGVSMVTSQMLGVFR
EDARTRSEFLSYIGIARGVR
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaggccaaccgaccggacgtcagccgcgagcaggcggaggaagcgatccgt
accctgttgctgtgggccggggaagatcctgctcgcgaaggactgatcgataccccgaag
cgggtcgtcaaggcctattcggactggtttgccggctatgcctcggacccggcggattat
ctgctgcgaaccttcgaggaggtcggcggctatgacgagatggtcgtgctgcgcgacatc
gaattcgaaagccactgcgaacaccatatggcagccatcatcggcaaggcgcatatcgcc
tatctgccggacaaccgggtggtcggcatcagcaagctggcccgcgtggtcgacggtttt
gcccgccgactgcaggtccaggagaagatgaccgcgcagatcgcccagtgcatccaggaa
accctgcagcccaagggcgtggccgtggtcatcgaggccgcccatgaatgcatgaccacc
cgtggcgtgcacaagcgcggcgtatcgatggtcaccagccagatgctgggcgtgttccgc
gaggacgcgcggacccggtccgaattcctgtcctatatcggcatcgcccgcggcgtgcgc
tga

DBGET integrated database retrieval system