KEGG   Frateuria aurantia: Fraau_3156Help
Entry
Fraau_3156        CDS       T01773                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fau  Frateuria aurantia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fraau_3156
Enzymes [BR:fau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Fraau_3156
Exosome [BR:fau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fraau_3156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3429002..3429997)
Genome map
AA seq 331 aa AA seqDB search
MSYPTTRMRRMRRHAFSRAMMREHTLLPSDLIMVAFVREGEGQREPVPSMPGVERLSIDE
LLKLAGECVRLGIPALALFPSAGDAVKTEDGREAWNPDGLFQRACRQLKAAYPELGLIGD
AALDPYTTHGQDGIIDENGYVMNEPTIEALIKMSLAQAEAGMDFIAPSDMMDGRIGAIRD
ALEEAGYIHTRIMAYSAKYASAFYGPFRDAVGSSASLGKADKHTYQMDVANSDEALREVE
LDLQEGADAVMVKPGMPYLDVLRRVKDAFGAPTFVYQVSGEYAMLKAAVQNGWLDEKAVV
LESLTAFKRAGADGILTYYAIDAARWLRGED
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagttaccccaccacccggatgcggcgcatgcgccgtcacgctttctcgcgcgccatg
atgcgcgaacacactctgctgcccagcgacctgatcatggtcgccttcgttcgcgaaggt
gaaggccagcgtgaaccggtgccctcgatgccgggtgtcgagcgtctgtccatcgatgag
ctgctgaaactcgccggcgagtgcgtgcgtctgggcattcccgcgctggccttgtttccc
tccgcgggcgacgccgtgaaaaccgaggacgggcgtgaagcctggaatccggacgggctg
ttccagcgcgcctgccgtcagctgaaggcggcttatccggaactgggcctgatcggcgat
gcagcgctggatccttataccacccatggtcaggacggcatcatcgacgagaacggctat
gtgatgaacgagccgaccatcgaggcgctgatcaagatgtcgctggcccaggccgaggcc
ggcatggatttcatcgcgccttcggacatgatggacggtcgcatcggcgccatccgcgat
gcgctggaggaagccggttacatccacacccggatcatggcctattcggccaaatacgcc
tcggccttctatggcccgttccgtgatgcggtcggttcgtccgccagcctgggcaaggcc
gacaagcacacctaccagatggacgttgccaacagcgatgaagccctgcgtgaggtcgag
ctggatctgcaggaaggtgctgatgcggtgatggtcaagcccggcatgccgtatctggat
gtgctgcgccgtgtcaaggacgcctttggcgcgccgacctttgtctaccaggtcagtggt
gaatacgcgatgctgaaggccgccgtgcagaatggctggctggatgaaaaggcagtggtg
ctggagtcgctgacggccttcaagcgcgccggtgccgatggcattctgacctattacgcg
atcgatgccgcgcgctggctgcgcggcgaagactga

DBGET integrated database retrieval system