KEGG   Frateuria aurantia: Fraau_3157Help
Entry
Fraau_3157        CDS       T01773                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fraau_3157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_3157
   00052 Galactose metabolism
    Fraau_3157
   00500 Starch and sucrose metabolism
    Fraau_3157
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_3157
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fraau_3157
   00524 Butirosin and neomycin biosynthesis
    Fraau_3157
Enzymes [BR:fau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fraau_3157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3430303..3431325
Genome map
AA seq 340 aa AA seqDB search
MVASHAAPTLLADLGGTNVRFAISHPDRERPMLEESIRRYHVADFGSLGEAAAEYLRDTG
LEARRAIIAAAGRIVDNESVKITNNPWQISSRELAGKLKLESVHLVNDFAAQSMAVLLLQ
PKDLVPVGPLALPEPGHDEEQTFVIVGPGTGLGVGGLLLRPGGRSSILQTEGGHAGFAAH
TAEDIEILRYLNVRFGRVSSERLLSGQGLVNLYDAICAIQGKKAEALKPEDVTRLAETGA
DTLCEQALETFAGIFGSVSGDLVLGIGGWDGVYLTGGMIPILLPWVQKGLFRQRFEAKGR
FQETMATVPTQAIMNPEPGLVGCAAMSVAESGGKLMHRFN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtcgccagtcacgctgccccgacgctactcgccgacttgggcggaaccaacgtccgc
tttgccatctcccatcccgaccgggaacggccgatgctggaagaaagcatccgccgctac
catgtcgctgatttcggttcgctgggcgaggcggcggcggaatatctgcgcgataccggt
ctggaggccaggcgagcgatcatcgccgcggccggccgcatcgtcgacaacgagtcggtg
aagatcaccaacaatccctggcagatttcttcccgtgagctggcgggcaagctgaagctg
gagtcggtgcatctggtcaatgacttcgcggcccagagcatggccgtgctgttgctgcag
cccaaggatctggtgccggtcggcccgctggccctgcccgaacctggccatgacgaggaa
cagactttcgtcatcgtgggacccggtaccggtctgggcgtgggcggcctgctgctgcgc
cccggtggccgcagcagcattctgcagaccgaaggcggccacgccggctttgccgcgcat
accgccgaagacatcgagatcctgcgctatctcaatgtgcgcttcggccgggtttccagc
gaacgcctgctgagcggtcagggactggtcaatctgtatgacgcgatctgcgcgatccag
ggcaagaaggccgaagccctgaaaccggaggacgtcacccgcctggccgagaccggtgcc
gacaccctgtgcgaacaggcactggaaacctttgccggcattttcggcagcgtctccggc
gatctggtgctgggcatcggcggctgggatggggtctatctgaccggcggcatgattccg
atcctgctgccatgggtgcagaaaggcctgttccggcaacgcttcgaagccaagggccgc
ttccaggaaaccatggcgacggtaccgacccaggcgatcatgaatccggagccgggcctg
gtcggttgtgccgccatgtccgttgccgaatccggcggcaagctgatgcaccgcttcaac
tga

DBGET integrated database retrieval system