KEGG   Frateuria aurantia: Fraau_3194Help
Entry
Fraau_3194        CDS       T01773                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fau  Frateuria aurantia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fau01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:fau00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:fau00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3477445..3478764
Genome map
AA seq 439 aa AA seqDB search
MSRPMVFHSTRDATVSAGLSQAIAAGLAPDGGLYVPAALPRQHPADFAAGADLAETACQL
LQPFFAGDPLEVELPAICREAFTFQAPLRTLGFGEAQVLELFHGPTAAFKDFGARFLAAC
LRRLPRADARPLTILVATSGDTGAAVGAAFDGLPGLQVMILYPDGKVSPRQAHQLGSFGG
NVQALKVTGRFDDCQRMVKAALNDGRLQADVPLSSANSISLGRLLPQMAYYAQACLQEWQ
REGRLLNLIIPTGNLGNALAATWVRAMGLPIGEIVLSCNANRTLPDYFDGQDYRPREAVA
TLANAMDVGAPSNFERLRWTFPEEELLRRHLRAFSIDDADIMTSLKRHALDDGELLCPHT
STAAAVLDRLRQAADHRPWTLVATAHPAKFETVIEPLISRPVAVPPALQTMLDRPARARS
IPPSDSMLAACLRAFPSDQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccccatggtcttccacagcacccgtgatgccaccgtcagcgccggcttgagc
caggccatcgcggcaggacttgcgccggacggcggcctttatgtcccggccgcactgccg
cgacagcatccggccgactttgccgccggggccgatctggccgaaaccgcctgtcagctg
ctgcagccgttttttgccggcgatccgctggaggtcgaactgcccgccatctgccgtgaa
gccttcaccttccaggctccgctgcggactctgggtttcggcgaagcgcaggtgctggag
ctgttccatggccccacggccgccttcaaggattttggtgcccgctttctggccgcctgt
ctgcgtcgcctgccccgcgccgacgctcgcccgctgaccatcctggtagccacatccggt
gataccggcgcggcagtcggcgccgccttcgatggtctgcccgggctgcaggtgatgatc
ctgtatccggacggcaaggtatcaccacgtcaggcccatcagctgggcagtttcggcggc
aatgtccaggccctcaaggtcaccggccgcttcgacgactgccagcgcatggtcaaggcc
gccctgaatgatggccggctgcaagccgacgtgcccttgtcctcggccaacagcatcagt
ctgggtcggctgctgccgcagatggcctattacgcccaggcttgcctgcaggaatggcag
cgcgaaggacgtctcctgaacctgatcattcccaccggcaatctcggcaatgcgctggcc
gccacctgggtccgcgccatgggcctgccgatcggcgagatcgtgctcagctgcaatgcc
aatcgcaccttgccggactatttcgacggccaggactaccgccctcgcgaggccgtggcc
actctggccaatgccatggacgtcggtgcacccagcaatttcgagcgattgcgctggacc
ttcccggaggaagagctgctgcgccggcatctgcgcgccttcagcattgatgatgcggac
atcatgaccagcctgaagcgccatgccctcgatgacggcgagctgctgtgcccgcatacc
tcgaccgcggccgccgtgctggatcgcctgcgccaggcggccgatcaccgcccctggacc
ctggtcgccaccgcgcatccggccaagttcgaaaccgtgatcgaacccctgatcagccgg
ccggtggctgttccgcctgctttgcagaccatgctggaccgtcctgcccgcgccaggtcg
ataccgccctccgattcgatgctcgctgcctgcctgcgtgccttcccgtcagatcagtga

DBGET integrated database retrieval system