KEGG   Frateuria aurantia: Fraau_3194Help
Entry
Fraau_3194        CDS       T01773                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fau  Frateuria aurantia
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fraau_3194
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fraau_3194
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fraau_3194
Enzymes [BR:fau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fraau_3194
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3477445..3478764
Genome map
AA seq 439 aa AA seqDB search
MSRPMVFHSTRDATVSAGLSQAIAAGLAPDGGLYVPAALPRQHPADFAAGADLAETACQL
LQPFFAGDPLEVELPAICREAFTFQAPLRTLGFGEAQVLELFHGPTAAFKDFGARFLAAC
LRRLPRADARPLTILVATSGDTGAAVGAAFDGLPGLQVMILYPDGKVSPRQAHQLGSFGG
NVQALKVTGRFDDCQRMVKAALNDGRLQADVPLSSANSISLGRLLPQMAYYAQACLQEWQ
REGRLLNLIIPTGNLGNALAATWVRAMGLPIGEIVLSCNANRTLPDYFDGQDYRPREAVA
TLANAMDVGAPSNFERLRWTFPEEELLRRHLRAFSIDDADIMTSLKRHALDDGELLCPHT
STAAAVLDRLRQAADHRPWTLVATAHPAKFETVIEPLISRPVAVPPALQTMLDRPARARS
IPPSDSMLAACLRAFPSDQ
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgagccgccccatggtcttccacagcacccgtgatgccaccgtcagcgccggcttgagc
caggccatcgcggcaggacttgcgccggacggcggcctttatgtcccggccgcactgccg
cgacagcatccggccgactttgccgccggggccgatctggccgaaaccgcctgtcagctg
ctgcagccgttttttgccggcgatccgctggaggtcgaactgcccgccatctgccgtgaa
gccttcaccttccaggctccgctgcggactctgggtttcggcgaagcgcaggtgctggag
ctgttccatggccccacggccgccttcaaggattttggtgcccgctttctggccgcctgt
ctgcgtcgcctgccccgcgccgacgctcgcccgctgaccatcctggtagccacatccggt
gataccggcgcggcagtcggcgccgccttcgatggtctgcccgggctgcaggtgatgatc
ctgtatccggacggcaaggtatcaccacgtcaggcccatcagctgggcagtttcggcggc
aatgtccaggccctcaaggtcaccggccgcttcgacgactgccagcgcatggtcaaggcc
gccctgaatgatggccggctgcaagccgacgtgcccttgtcctcggccaacagcatcagt
ctgggtcggctgctgccgcagatggcctattacgcccaggcttgcctgcaggaatggcag
cgcgaaggacgtctcctgaacctgatcattcccaccggcaatctcggcaatgcgctggcc
gccacctgggtccgcgccatgggcctgccgatcggcgagatcgtgctcagctgcaatgcc
aatcgcaccttgccggactatttcgacggccaggactaccgccctcgcgaggccgtggcc
actctggccaatgccatggacgtcggtgcacccagcaatttcgagcgattgcgctggacc
ttcccggaggaagagctgctgcgccggcatctgcgcgccttcagcattgatgatgcggac
atcatgaccagcctgaagcgccatgccctcgatgacggcgagctgctgtgcccgcatacc
tcgaccgcggccgccgtgctggatcgcctgcgccaggcggccgatcaccgcccctggacc
ctggtcgccaccgcgcatccggccaagttcgaaaccgtgatcgaacccctgatcagccgg
ccggtggctgttccgcctgctttgcagaccatgctggaccgtcctgcccgcgccaggtcg
ataccgccctccgattcgatgctcgctgcctgcctgcgtgccttcccgtcagatcagtga

DBGET integrated database retrieval system