KEGG   Frateuria aurantia: Fraau_3210Help
Entry
Fraau_3210        CDS       T01773                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
fau  Frateuria aurantia
Brite
Enzymes [BR:fau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Fraau_3210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3496544..3497521)
Genome map
AA seq 325 aa AA seqDB search
MKALVTGASGFVGSAMVRRLLDEGVSVRVLVRPRSDRSNLQGLPVELAEGDLTRAETLPA
ACRGCDALFHVAADYRLWTPRPAELYQANVEGTRALLTAARDNGVQRVVYTSSVATLGIP
KDHTPGTEFTPVTVADMIGHYKRSKFLAEEVAAEFAAAGLDLVIVNPSTPIGPRDIKPTP
TGRVVRDAMLGKIPAYVDTGLNIAHVDDVAEGHWLAWQKGVAGQRYILGGQDLTLRELLT
EIADIVGRPPPRIRLPHNLVLPVAYVSEALARITGKAPVATVEEIKMSKKMMFFSSARAK
AELGYRPRPARQALEDAVNWFRQRA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcactggtaacaggcgcgagcggattcgtcgggtccgccatggtccggcgattg
ctcgatgaaggggtgtcggttagggttctggtccgtccccgctccgatcgcagcaatctg
caggggctgcccgtcgagctggccgagggcgatctgacccgggccgaaaccttgcctgcg
gcctgccgaggctgcgatgcactgtttcatgtggccgccgactaccggctgtggactccg
cgaccggccgagttgtatcaggccaatgtcgagggcacccgggccttgctgacggcagca
cgtgacaacggcgtgcagcgggtggtgtataccagcagcgtcgctaccctcggcattccc
aaggatcacacccccggcaccgaattcacgccggtgaccgtggccgacatgatcggccat
tacaagcggtccaagttcctcgccgaggaagtggccgcggaattcgccgcggccggcctg
gatctggtgatcgtcaacccctcgaccccgatcggaccgcgtgacatcaagcccacgccc
accgggcgggtggtgcgtgatgccatgctgggcaagattcccgcctatgtggataccggc
ctcaatatcgcgcatgtcgatgacgtggccgaaggtcactggctggcctggcagaagggt
gtggccggacagcgttatattctgggcggccaggacctgaccctgcgcgaattgctgacc
gaaatcgccgatatcgtcggtcgaccgccgccgcggatccgcctgccacacaatctggtg
ctgccggtggcctatgtttccgaggctttggcgcggatcaccggcaaggcaccggtggcg
acggtggaagagatcaaaatgtcgaagaagatgatgttcttctccagtgcccgggccaag
gccgagctgggctatcgaccgcgtccggcgcgccaggcgctggaagatgccgtgaactgg
ttccgccagcgcgcctga

DBGET integrated database retrieval system