KEGG   Frateuria aurantia: Fraau_3229Help
Entry
Fraau_3229        CDS       T01773                                 

Definition
formamidopyrimidine-DNA glycosylase Fpg
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
fau  Frateuria aurantia
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:fau03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3522046..3522873
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETTRRGIMPHVEGRVVTDVVLRRPDLRWPIPWAVVSELPGQRIESIERRGKYL
LLHTSVGSALLHLGMSGVLRVLPADTPVARHDHVDLVLETRPGEIPQVLRFTDPRRFGCL
LWQAPGEVHELLAKMDPEPLSEAFDGDVLWRVAQKRQSAVKLMLMDNAVVVGVGNIYANE
ALFAAGIDPRRAAAKISRARYQRLATEIRRILAWAIERGGTTLRDFISPDGMPGYFFREL
MVYGRAGEACLQCGSTIQTAMLGQRATCWCPRCQR
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaacttcccgaagttgaaaccacgcgtcgcggcatcatgccgcatgttgaaggg
cgcgtcgtgaccgatgtcgttctgcgccgcccggatctgcgttggccgattccctgggca
gtggtctcagagctgcccggccaacgtatcgagtcgatcgaacgtcgcggcaaatacctg
ttgctgcatacctccgtcggcagtgccctgcttcatctgggcatgtcaggcgtcctgcgg
gtgctgccggccgacacgccggtggccaggcacgaccatgtcgatctggtactggaaacc
cggccgggcgagattccgcaggtgctgcgctttaccgacccccgccgcttcggctgcctg
ctgtggcaagcccccggcgaggtgcatgaactgctggcaaaaatggaccccgagcccttg
tccgaagccttcgacggcgatgtgctgtggcgggtcgcgcaaaaacgccagagtgccgtc
aagctgatgctgatggacaatgcggtggtggtcggcgtcggcaacatctacgccaacgag
gccttgtttgctgccggcatcgatccgcgccgcgcggccgcgaagatctcccgggcacgc
tatcagcggctggcgaccgagatccgccggatcctggcctgggccatcgagcgcggcggt
accactttgcgggatttcatcagccccgacggcatgcccggctattttttccgcgagctg
atggtctacggacgtgccggcgaggcctgcctgcagtgcggcagcaccatccagaccgcg
atgctgggccagcgcgccacctgctggtgtccgcgctgccagcgctga

DBGET integrated database retrieval system