KEGG   Frateuria aurantia: Fraau_3262Help
Entry
Fraau_3262        CDS       T01773                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
fau  Frateuria aurantia
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fraau_3262
   00030 Pentose phosphate pathway
    Fraau_3262
   00051 Fructose and mannose metabolism
    Fraau_3262
   00052 Galactose metabolism
    Fraau_3262
   00500 Starch and sucrose metabolism
    Fraau_3262
   00520 Amino sugar and nucleotide sugar metabolism
    Fraau_3262
  Nucleotide metabolism
   00230 Purine metabolism
    Fraau_3262
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fraau_3262
Enzymes [BR:fau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Fraau_3262
    5.4.2.8  phosphomannomutase
     Fraau_3262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3566657..3568060)
Genome map
AA seq 467 aa AA seqDB search
MSIEVAPSYPVDPSIFRAYDIRGVVGKSLTPELAFLLGQAIGTVMKEKGLGHIVVGRDGR
LSGPELAGALAQGLNEAGIDVIDVGAVPTPVVYFAATHFDVGSGVAVTGSHNPPDYNGFK
IVVGGETLSEGAIQDLYQRMASRQLASGGGGSLRHEDVVPAYIQRITSDIKLKRPLKVIV
DCGNGIPGAVAPKVLEGIGAEVVPMYCEVDGTFPNHHPDPSDLHNLEDLIAELARSDADL
GVAFDGDGDRLGVVTRRGEVIFPDRLLMLFARDVASRVPGATIIYDVKCTGHLKGEIEKA
GALPLMWRTGHSLIKSKMRETKAELAGEMSGHFFFKERWFGFDDGIYAGARLLEILAAQS
GTAEQVFETLPKGVSTPELKIELAEGEHYAFIKKFVAQATFGDEAVLTTIDGVRADWPDG
WGLVRASNTTPVLVLRFDADDAEALQRIQAVYREQLLAVDPSLKIPF
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatcgaagtcgcaccgagctatcccgtggatccttccatttttcgtgcctatgac
atccgcggcgtcgtcggcaagtcgctgacccccgagctggcctttctgctgggccaggcc
atcggcacggtgatgaaggaaaaggggctgggccatatcgtggtcggccgtgacggtcgc
ctgtccggtcccgaactggccggcgccctggcccagggtctgaacgaggcgggcatcgac
gtgatcgacgtcggtgcggtgccgacgccggtggtgtatttcgcggcgacgcatttcgat
gtgggcagtggcgtggccgtcaccggcagccacaatccgccggactacaacggtttcaag
atcgtggtcggtggcgagaccttgtccgaaggcgcgatccaggatctgtaccagcggatg
gccagtcgccagctggccagtggcggcggtggctcgctgcggcatgaggatgtggtgccg
gcctatatccagcgcatcacctcggatatcaagctcaagcgcccgctgaaagtcatcgtc
gactgcggcaacggcattcccggtgccgtggcgcccaaggtgctggaaggcatcggcgcc
gaagtcgtgccgatgtactgcgaagtggacggcacctttcccaatcaccatcccgatccg
tcggacctgcacaatctggaagatctgatcgccgagctggcgcgctcggatgccgatctg
ggcgtggccttcgacggcgacggcgaccgtctgggcgtggtcacccgtcgcggcgaggtc
atcttcccggaccgtctgctgatgctgttcgcccgtgatgtggccagccgtgtgccgggt
gccaccatcatctatgacgtcaagtgcaccggtcatctcaagggcgaaatcgaaaaggcc
ggggcgctgccgctgatgtggcgtaccggccattcgctgatcaagagcaagatgcgcgag
accaaggccgagctggccggcgaaatgagtggtcatttcttcttcaaggagcgctggttc
gggtttgacgacggcatttatgccggtgcccgcctgctggaaatcctggccgcccagtcc
ggtaccgccgagcaggtgttcgagactctgcccaagggcgtctccacgcctgaattgaag
atcgagctggccgagggcgagcattacgccttcatcaagaagttcgtggcccaggccacc
ttcggtgacgaggcggtactgaccaccatcgatggtgtccgcgccgactggcctgatggc
tggggtctggtgcgtgcttccaataccactccggtgctggtgctgcgcttcgatgccgac
gatgccgaggccctgcagcggatccaggcggtgtatcgcgagcagttgctggcggtcgat
ccgtcgctgaagatcccgttttga

DBGET integrated database retrieval system