KEGG   Frateuria aurantia: Fraau_3266Help
Entry
Fraau_3266        CDS       T01773                                 

Definition
arginyl-tRNA synthetase
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
fau  Frateuria aurantia
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:fau00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Fraau_3266
Enzymes [BR:fau01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     Fraau_3266
Amino acid related enzymes [BR:fau01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Fraau_3266
Transfer RNA biogenesis [BR:fau03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Fraau_3266
 Prokaryotic Type
   Other AARSs
    Fraau_3266
Mitochondrial biogenesis [BR:fau03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Fraau_3266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3571238..3573001
Genome map
AA seq 587 aa AA seqDB search
MTLPTACPASGSVKIGSLRLIRLLAVKESLRELVLQAVQSLVTAGALPADLSLPAFVIER
ARSREHGDFATNLAMMLAKPARAKPRDIAQQLVDALPASPLVARCEIAGPGFINFFLSPQ
AYEAEVLRVLDQGEHYGRSTHGAGRRVGVEFVSANPTGPLHVGHGRAAAIGDCLSRLLHA
TGWDVKREFYYNDAGVQIQNLAISVQARARGISPDQAEWPEGGYRGDYIADVAQAYLNRE
TAMADGKEVVGAGDPENLEAIRQFAVASLRHEQDLDLKAFGAGFDVYFLESSLYAEGKVE
ETVRELIAHGHTYEEGGALWLKSTDFGDDKDRVMRKSDGSYTYFVPDVAYHLSKWQRGYE
RAITELGSDHHGSLARVKAGLQALDTGIPKNWPEYVLHQMVTVMRGGEEVKISKRAGSYV
TLRDLIEEVGRDATRFFLIARKADSQLVFDIDLARSQSNDNPVYYIQYAHARICSALRQA
EEKGMPFDEANGRAKLARLESEHEQILLGELSKLPEVLETAALNLEPHLVANWLRELAAA
FHGYYNSCQFLVDDKDLRDARLCLALATRQVIRNGLDLLGLGAPESM
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccgaccgcctgcccggcctcgggctctgttaaaatcggaagtttacgattg
atcagactcttagccgtgaaagaatcattgcgcgaactcgtcctgcaagccgtccagagc
ctggtcaccgccggcgccctgcccgctgatctgagcctgcctgccttcgtgatcgaacgg
gcacgcagccgcgagcacggggactttgccaccaatctggcgatgatgctggccaagccg
gcccgggccaaaccccgcgacattgcccagcagctggtcgacgccctgcccgcctcgccg
ctggtggcgcgctgcgaaatcgcaggccccggattcatcaattttttcctcagcccccag
gcctatgaagccgaagtgctgcgggtcctggaccagggtgaacattacggccgttccacc
catggtgccggccgccgcgtcggcgtcgagttcgtctcggccaatcccaccggtccgctg
catgtcggccatggccgtgccgctgcgatcggcgactgcctgagccggctgctgcacgct
accggctgggatgtgaaacgcgagttctactacaacgatgccggggtgcagatccagaat
ctggccatttcggtgcaggcgcgcgcccgcggcatcagtccggaccaggccgaatggccg
gaaggcggctatcgtggcgactatatcgccgacgtcgcccaggcctatctgaatcgtgaa
accgcgatggccgacggcaaggaagtggtcggtgccggtgatccggaaaatctggaggcg
atccgccagttcgccgtggccagcctgcgccatgaacaggatctggatctgaaggccttc
ggcgccggcttcgacgtctacttcctggaatcctcgctgtatgccgaaggcaaggtcgag
gaaaccgtgcgcgaattgatcgcccatggccatacctacgaggaaggcggcgcgctgtgg
ctgaagtccaccgacttcggcgatgacaaggaccgcgtgatgcgcaagtccgacggcagc
tacacctatttcgtgccggacgtcgcctaccatctcagcaagtggcagcgcggctacgag
cgcgccatcaccgagctgggctcggatcatcacggcagtctggcccgggtcaaggccggc
ctgcaggcactggacaccggcattccgaaaaactggcctgaatacgtgctgcaccagatg
gtgaccgtgatgcggggcggtgaagaggtcaagatctccaagcgcgccggcagctacgtg
accctgcgcgacctgatcgaggaagtcggtcgcgatgccacccgcttcttcctgatcgcc
cgcaaggccgattcgcaactggtgttcgacatcgatctggcccgctcgcagagcaacgac
aatccggtgtactacatccagtacgcgcatgcccgtatctgcagcgcgctgcgccaggcc
gaggaaaagggcatgcccttcgacgaggccaacggtcgggccaagctggctcggctggag
agcgagcacgagcagattctgctgggcgaactgtccaagctgcccgaagtgctggaaacc
gccgcgctgaatctggagccgcatctggtcgccaactggttgcgcgaacttgcagccgcc
ttccatgggtattacaactcctgtcagttcctggtggatgacaaggatctgcgcgatgcc
cggctgtgcctggccctcgccacccgccaagtgattcgcaacggactggacctgctgggc
ctcggtgccccggagagcatgtaa

DBGET integrated database retrieval system