KEGG   Frateuria aurantia: Fraau_3266Help
Entry
Fraau_3266        CDS       T01773                                 

Definition
arginyl-tRNA synthetase
Orthology
K01887  
arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
fau  Frateuria aurantia
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:fau00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3571238..3573001
Genome map
AA seq 587 aa AA seqDB search
MTLPTACPASGSVKIGSLRLIRLLAVKESLRELVLQAVQSLVTAGALPADLSLPAFVIER
ARSREHGDFATNLAMMLAKPARAKPRDIAQQLVDALPASPLVARCEIAGPGFINFFLSPQ
AYEAEVLRVLDQGEHYGRSTHGAGRRVGVEFVSANPTGPLHVGHGRAAAIGDCLSRLLHA
TGWDVKREFYYNDAGVQIQNLAISVQARARGISPDQAEWPEGGYRGDYIADVAQAYLNRE
TAMADGKEVVGAGDPENLEAIRQFAVASLRHEQDLDLKAFGAGFDVYFLESSLYAEGKVE
ETVRELIAHGHTYEEGGALWLKSTDFGDDKDRVMRKSDGSYTYFVPDVAYHLSKWQRGYE
RAITELGSDHHGSLARVKAGLQALDTGIPKNWPEYVLHQMVTVMRGGEEVKISKRAGSYV
TLRDLIEEVGRDATRFFLIARKADSQLVFDIDLARSQSNDNPVYYIQYAHARICSALRQA
EEKGMPFDEANGRAKLARLESEHEQILLGELSKLPEVLETAALNLEPHLVANWLRELAAA
FHGYYNSCQFLVDDKDLRDARLCLALATRQVIRNGLDLLGLGAPESM
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgccgaccgcctgcccggcctcgggctctgttaaaatcggaagtttacgattg
atcagactcttagccgtgaaagaatcattgcgcgaactcgtcctgcaagccgtccagagc
ctggtcaccgccggcgccctgcccgctgatctgagcctgcctgccttcgtgatcgaacgg
gcacgcagccgcgagcacggggactttgccaccaatctggcgatgatgctggccaagccg
gcccgggccaaaccccgcgacattgcccagcagctggtcgacgccctgcccgcctcgccg
ctggtggcgcgctgcgaaatcgcaggccccggattcatcaattttttcctcagcccccag
gcctatgaagccgaagtgctgcgggtcctggaccagggtgaacattacggccgttccacc
catggtgccggccgccgcgtcggcgtcgagttcgtctcggccaatcccaccggtccgctg
catgtcggccatggccgtgccgctgcgatcggcgactgcctgagccggctgctgcacgct
accggctgggatgtgaaacgcgagttctactacaacgatgccggggtgcagatccagaat
ctggccatttcggtgcaggcgcgcgcccgcggcatcagtccggaccaggccgaatggccg
gaaggcggctatcgtggcgactatatcgccgacgtcgcccaggcctatctgaatcgtgaa
accgcgatggccgacggcaaggaagtggtcggtgccggtgatccggaaaatctggaggcg
atccgccagttcgccgtggccagcctgcgccatgaacaggatctggatctgaaggccttc
ggcgccggcttcgacgtctacttcctggaatcctcgctgtatgccgaaggcaaggtcgag
gaaaccgtgcgcgaattgatcgcccatggccatacctacgaggaaggcggcgcgctgtgg
ctgaagtccaccgacttcggcgatgacaaggaccgcgtgatgcgcaagtccgacggcagc
tacacctatttcgtgccggacgtcgcctaccatctcagcaagtggcagcgcggctacgag
cgcgccatcaccgagctgggctcggatcatcacggcagtctggcccgggtcaaggccggc
ctgcaggcactggacaccggcattccgaaaaactggcctgaatacgtgctgcaccagatg
gtgaccgtgatgcggggcggtgaagaggtcaagatctccaagcgcgccggcagctacgtg
accctgcgcgacctgatcgaggaagtcggtcgcgatgccacccgcttcttcctgatcgcc
cgcaaggccgattcgcaactggtgttcgacatcgatctggcccgctcgcagagcaacgac
aatccggtgtactacatccagtacgcgcatgcccgtatctgcagcgcgctgcgccaggcc
gaggaaaagggcatgcccttcgacgaggccaacggtcgggccaagctggctcggctggag
agcgagcacgagcagattctgctgggcgaactgtccaagctgcccgaagtgctggaaacc
gccgcgctgaatctggagccgcatctggtcgccaactggttgcgcgaacttgcagccgcc
ttccatgggtattacaactcctgtcagttcctggtggatgacaaggatctgcgcgatgcc
cggctgtgcctggccctcgccacccgccaagtgattcgcaacggactggacctgctgggc
ctcggtgccccggagagcatgtaa

DBGET integrated database retrieval system